BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0184 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) 31 0.89 SB_25728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) Length = 761 Score = 31.1 bits (67), Expect = 0.89 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +3 Query: 552 FLTFFAIPFIFNQT*IVYFTWNVYRTFFVFLVFYTIFLYFCFCSAFL 692 F FFA F + V F + VY FF+F+VF + F F AF+ Sbjct: 667 FSFFFAFAFRRLRLDSVVFAFVVYPYFFLFVVFAFVVFIFIFFFAFV 713 >SB_25728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 299 LSTLVSKF*TWK*ISPVSIFLWNVFI-RF*YERTRSLY*FLV 421 LS L++ F +WK +P + L VF+ + YER R++ +L+ Sbjct: 131 LSKLITDFVSWKEATPYAAILSGVFLFQCKYERNRAVLNYLM 172 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,467,703 Number of Sequences: 59808 Number of extensions: 278638 Number of successful extensions: 567 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -