BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0183 (798 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79597-1|CAB01861.1| 271|Caenorhabditis elegans Hypothetical pr... 30 2.2 Z70308-11|CAA94343.4| 378|Caenorhabditis elegans Hypothetical p... 30 2.2 AF098997-9|AAC68720.1| 325|Caenorhabditis elegans Serpentine re... 28 6.7 >Z79597-1|CAB01861.1| 271|Caenorhabditis elegans Hypothetical protein C33A11.2 protein. Length = 271 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 85 RTFFVFLVFYTIFLYFCFCSAF 20 RT F + V +TIF CFC +F Sbjct: 157 RTVFYYRVIFTIFSVICFCCSF 178 >Z70308-11|CAA94343.4| 378|Caenorhabditis elegans Hypothetical protein F49E11.2 protein. Length = 378 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -3 Query: 796 LMLVKIARAKMRLWMIRCFDAFNRLRYYVCKIEMLPWLILDATFSLQSGK 647 L L IA + LW +R F+ + ++ +I +LPWL LD +L S + Sbjct: 298 LRLETIAGGAVLLWCVRII--FDVVIAFLSEIRLLPWLRLDNLQTLDSSR 345 >AF098997-9|AAC68720.1| 325|Caenorhabditis elegans Serpentine receptor, class i protein42 protein. Length = 325 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 121 QT*IVYFTWNVYRTFFVFLVFYTIFLYF 38 Q ++Y +NVY TFFV FL F Sbjct: 176 QNYVIYRDYNVYMTFFVIFKMVATFLVF 203 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,038,757 Number of Sequences: 27780 Number of extensions: 284000 Number of successful extensions: 769 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -