BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0177 (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 24 1.2 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 3.8 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 5.0 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 8.7 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 235 VDSFRAQWYLQPAKYDKDNLFYIYNREYSKAL 140 +D+ R W AKYDKD +Y ++Y + Sbjct: 94 IDNKRDWWNELEAKYDKDG---VYRQKYKDVI 122 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -2 Query: 416 WQTSSATVRTKQARKSA 366 WQ+S +++R + ++KSA Sbjct: 231 WQSSESSLRPRSSQKSA 247 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.8 bits (44), Expect = 5.0 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 533 MSLEPWSQS**AYSMQFILLFRISLFTTFVMTSLFF 640 +S+EP S YS+ +ILLF + + + V + F+ Sbjct: 21 VSVEPTGFSPKGYSLLWILLFTLGVTISGVYRTDFY 56 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 247 GVNSVDSFRA 218 GVNS DSF+A Sbjct: 26 GVNSADSFKA 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,103 Number of Sequences: 336 Number of extensions: 2888 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -