BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0168 (699 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4FSG8 Cluster: Putative uncharacterized protein; n=1; ... 49 1e-04 UniRef50_A5Z1D8 Cluster: Putative uncharacterized protein; n=1; ... 44 0.004 UniRef50_A7FPQ7 Cluster: Conserved domain protein; n=3; Clostrid... 35 2.2 >UniRef50_A4FSG8 Cluster: Putative uncharacterized protein; n=1; Thermobia domestica|Rep: Putative uncharacterized protein - Thermobia domestica (firebrat) Length = 53 Score = 49.2 bits (112), Expect = 1e-04 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = -1 Query: 246 LRPRCWIKIKFKCRSLKF*SVRSLKSYMI 160 LRPRCWIKI +CRSL + SVR LKSYMI Sbjct: 25 LRPRCWIKILSRCRSLVYRSVRPLKSYMI 53 >UniRef50_A5Z1D8 Cluster: Putative uncharacterized protein; n=1; Haemaphysalis qinghaiensis|Rep: Putative uncharacterized protein - Haemaphysalis qinghaiensis Length = 30 Score = 44.0 bits (99), Expect = 0.004 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -3 Query: 211 M*KFKILICSIIKILHDLSSNRCEPGWFLS 122 M K K +CS +ILHDLS +RCE GWFLS Sbjct: 1 MKKLKKEVCSTFEILHDLSLDRCESGWFLS 30 >UniRef50_A7FPQ7 Cluster: Conserved domain protein; n=3; Clostridium botulinum A|Rep: Conserved domain protein - Clostridium botulinum (strain ATCC 19397 / Type A) Length = 479 Score = 34.7 bits (76), Expect = 2.2 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -3 Query: 202 FKILICSIIKILHDLSSNRCEPGWFLSFNIYNILVRK 92 +KI IIK+++ L N CE G+ SFN YN + ++ Sbjct: 277 YKISDYRIIKLINALEDNSCEVGYHYSFNSYNSISKR 313 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 457,529,552 Number of Sequences: 1657284 Number of extensions: 7034478 Number of successful extensions: 10821 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10820 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -