BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0167 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.3 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 7.0 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 21 9.3 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 21 9.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.3 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 272 SSLKNHYFHCFITYSVGRK 328 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.8 bits (44), Expect = 7.0 Identities = 14/49 (28%), Positives = 19/49 (38%) Frame = +1 Query: 454 GGEFDWGGTSVKE*RRCPRPAQRGQKPRVEQKGKSWLDPDVQYA*GLRK 600 GG+ DW + E C PR + G + L + Y G RK Sbjct: 119 GGDLDWKYYTTNESHACLSTGGSCYWPRGKNLGGTTLHHGMAYHRGHRK 167 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 266 ARSSLKNHYFHCFI 307 A L+N Y+ CFI Sbjct: 37 ANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 266 ARSSLKNHYFHCFI 307 A L+N Y+ CFI Sbjct: 37 ANDRLRNQYYDCFI 50 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 247 ATPLMSPYNARLESSSTGSSFP 182 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,006 Number of Sequences: 438 Number of extensions: 4634 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -