BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0160 (607 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.0 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 1.4 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 4.2 At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s... 28 5.5 At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /... 27 7.3 At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family p... 27 9.6 At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family p... 27 9.6 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 78 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 194 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 61 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 195 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 85 RVRIQSET*DDFRECHIKYIQFLRPH 8 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At5g22740.1 68418.m02656 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 534 Score = 27.9 bits (59), Expect = 5.5 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +1 Query: 13 ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 177 ASK + I Y RENR+ ++ G+ GL R + V+ C + + D P F Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204 >At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from [Arabidopsis thaliana] Length = 1909 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 356 GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKK 487 G +P + +SD + INE+ P +AK +E + GK+ Sbjct: 70 GGGLPNNGVSDTNSQINEVTVTP-QVIAKETVKENGLQKNGGKR 112 >At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 367 HLATLRES*LLPPFTRACLNFFTLTFRALGRNH 269 HLAT+ + L P +A N F FRA+ RN+ Sbjct: 174 HLATILHASLRTPNLKARFNTFREEFRAVWRNY 206 >At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 367 HLATLRES*LLPPFTRACLNFFTLTFRALGRNH 269 HLAT+ + L P +A N F FRA+ RN+ Sbjct: 174 HLATILHASLRTPNLKARFNTFREEFRAVWRNY 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,462,434 Number of Sequences: 28952 Number of extensions: 279087 Number of successful extensions: 733 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -