BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0159 (774 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49960.1 68418.m06186 expressed protein ; expression supporte... 28 6.0 At2g24710.1 68415.m02952 glutamate receptor family protein (GLR2... 28 6.0 At5g19120.1 68418.m02275 expressed protein low similarity to ext... 28 7.9 >At5g49960.1 68418.m06186 expressed protein ; expression supported by MPSS Length = 824 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 262 WRGEVIVNSCDTLNNPLLRV 203 W+G V+V CD N PL+++ Sbjct: 403 WKGHVVVEMCDLDNEPLVKL 422 >At2g24710.1 68415.m02952 glutamate receptor family protein (GLR2.3) plant glutamate receptor family, PMID:11379626 Length = 895 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 83 FCGAYDMIVGDTVHRKMVFHQRVKDFAIPFKKRIKTL--SYTDPEKR 217 + G YD +VGDT +V DF PF K L TDP KR Sbjct: 526 YLGRYDAVVGDTT--ILVNRSSYVDFTFPFIKSGVGLIVEMTDPVKR 570 >At5g19120.1 68418.m02275 expressed protein low similarity to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741, SP|P13917 Basic 7S globulin precursor {Glycine max} Length = 386 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 297 GVADTAFRDVSAGVEKSLSIAATPLIIRFSGSV*LNVFILFLNG 166 GV T+ + GV S S+ TPL+ SG+ +NV + +NG Sbjct: 204 GVVSTSSVEEVFGVAASRSLVYTPLLTGSSGNYVINVKSIRVNG 247 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,925,972 Number of Sequences: 28952 Number of extensions: 288101 Number of successful extensions: 619 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -