BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0156 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 24 1.3 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 9.1 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 9.1 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 9.1 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 9.1 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 9.1 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +1 Query: 214 IENLYFLFFGKYMLRLHKIINYLGRYIPIYSIL 312 + NL++LF G Y L + ++ P+ IL Sbjct: 34 LSNLFWLFVGTYFPSLIGANEHYSKFFPVSEIL 66 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 239 KNKKYKFSINY*KYLVCWESLSRSSSK 159 + K YK +Y KY W+ SR ++ Sbjct: 46 EQKSYKNENSYRKYRETWKERSRDRTE 72 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 239 KNKKYKFSINY*KYLVCWESLSRSSSK 159 + K YK +Y KY W+ SR ++ Sbjct: 46 EQKSYKNENSYRKYRETWKERSRDRTE 72 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 239 KNKKYKFSINY*KYLVCWESLSRSSSK 159 + K YK +Y KY W+ SR ++ Sbjct: 46 EQKSYKNENSYRKYRETWKERSRDRTE 72 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 239 KNKKYKFSINY*KYLVCWESLSRSSSK 159 + K YK +Y KY W+ SR ++ Sbjct: 46 EQKSYKNENSYRKYRETWKERSRDRTE 72 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = -3 Query: 284 PK*FIILCNLNIYLPKNKKYKF 219 P+ I+ + N+Y+ K+ +Y+F Sbjct: 96 PRDVEIILSSNVYIDKSTEYRF 117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,143 Number of Sequences: 438 Number of extensions: 3448 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -