BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0154 (734 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 27 2.8 SPBC21.02 |||TLDc domain protein 2|Schizosaccharomyces pombe|chr... 27 3.7 SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosa... 26 4.8 SPBC11B10.01 |alg2|SPBC32H8.14|mannosyltransferase complex subun... 26 4.8 SPAC57A10.08c |||esterase/lipase |Schizosaccharomyces pombe|chr ... 25 8.5 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 27.1 bits (57), Expect = 2.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -1 Query: 308 VTFVNFLSAFRCLSDVVSRRSEHLTLQSLPGLAPLLH 198 + F+N + A C+ VVS RSE +++ L + PL + Sbjct: 3574 ICFLNSIGAINCVGIVVSGRSE-ISMDCLEVMGPLFN 3609 >SPBC21.02 |||TLDc domain protein 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 26.6 bits (56), Expect = 3.7 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 3/23 (13%) Frame = +3 Query: 597 QIAY-SNLERN-C-FDKNVGLSF 656 Q+ Y SNL++N C FDKNVGL F Sbjct: 412 QVYYASNLDKNYCMFDKNVGLGF 434 >SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 26.2 bits (55), Expect = 4.8 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 520 VNILTLYKFRLTFALSRKLENSH*AYRLRIQIWSAIASTKMWG 648 +N +LYK ++F LS + N YR Q W + + +G Sbjct: 244 LNEFSLYKTNISFYLSNFIVNGVLQYRKEFQRWLRLYEFRRFG 286 >SPBC11B10.01 |alg2|SPBC32H8.14|mannosyltransferase complex subunit Alg2|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 613 FEYAICTLSASFLTFSITQKLT 548 F C +S SFLTF++ KLT Sbjct: 488 FMLGTCIVSVSFLTFTVYAKLT 509 >SPAC57A10.08c |||esterase/lipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 364 Score = 25.4 bits (53), Expect = 8.5 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = +1 Query: 550 LTFALSRKLENSH*AYRLRIQIWSAIASTKMW 645 +T +LS+ ++ A R ++ +W+ ++TK+W Sbjct: 248 VTRSLSKNIKGDGDAVRAQLWLWNRQSNTKIW 279 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,776,562 Number of Sequences: 5004 Number of extensions: 51152 Number of successful extensions: 144 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -