BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0154 (734 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0594 - 9695616-9696042,9696646-9697260,9697410-9697717,970... 29 5.1 >03_02_0594 - 9695616-9696042,9696646-9697260,9697410-9697717, 9700145-9700235,9700698-9700759,9701256-9702962, 9703789-9703870,9703972-9704057,9704855-9704968, 9705113-9705163,9705261-9705358,9707084-9707546 Length = 1367 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -1 Query: 314 EAVTFVNFLSAFRCLSDVVSRRSEHLTLQSLPGLAPLLHQYRSLI 180 + VTF LSA V R ++Q++ G++P++ QY ++ Sbjct: 731 DTVTFTTVLSACAHSGKVAEARKVFNSMQAVFGISPVIEQYACMV 775 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,769,305 Number of Sequences: 37544 Number of extensions: 328390 Number of successful extensions: 736 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 736 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -