Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0153
         (693 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8ID46 Cluster: Putative uncharacterized protein MAL13P...    33   8.8  

>UniRef50_Q8ID46 Cluster: Putative uncharacterized protein
            MAL13P1.333; n=3; Plasmodium|Rep: Putative
            uncharacterized protein MAL13P1.333 - Plasmodium
            falciparum (isolate 3D7)
          Length = 3482

 Score = 32.7 bits (71), Expect = 8.8
 Identities = 20/64 (31%), Positives = 27/64 (42%)
 Frame = +1

Query: 43   YYFSIVSSLFSMR*KQNFFLYLKKLLIAIQLPRLFLVNFINNLKNGSVQSRIALCKKCHR 222
            +   I+   F    K N+   +K L +  +   + L NFINNLK    Q  I    K   
Sbjct: 2170 FLLDIIKICFFNNYKNNYNKLIKLLYLPSEKLLIILYNFINNLKKIFPQELIRFIIKISS 2229

Query: 223  TFFH 234
            T FH
Sbjct: 2230 TIFH 2233


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 536,368,480
Number of Sequences: 1657284
Number of extensions: 9160011
Number of successful extensions: 16976
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 16366
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16974
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 54545459628
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)