Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0152
         (732 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    24   4.2  
DQ974166-1|ABJ52806.1|  494|Anopheles gambiae serpin 6 protein.        23   7.4  
AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh...    23   7.4  
AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    23   7.4  
AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    23   7.4  

>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal
            structural protein protein.
          Length = 1645

 Score = 24.2 bits (50), Expect = 4.2
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = +1

Query: 187  HHQSH*TQGIPNGPA 231
            HH  H  +G+P GPA
Sbjct: 1322 HHHHHGGEGVPMGPA 1336


>DQ974166-1|ABJ52806.1|  494|Anopheles gambiae serpin 6 protein.
          Length = 494

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +3

Query: 189 SPKPLNPRYSQWTRPT 236
           SP+P++ R  QW R T
Sbjct: 164 SPEPIDSRRDQWRRQT 179


>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative
           cell-adhesion protein protein.
          Length = 1881

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 106 IHLDDESGPVSRVASEQGPARRTRMGRHHQS 198
           +HLD  +G V+ +ASE     R  + +H+ S
Sbjct: 564 LHLDPHAGTVTLMASESPVFDREIIQKHYLS 594


>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
           protease protein.
          Length = 1322

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 227 PPNDTDPDE 253
           PPN TDPDE
Sbjct: 824 PPNGTDPDE 832


>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
           protein.
          Length = 1322

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +2

Query: 227 PPNDTDPDE 253
           PPN TDPDE
Sbjct: 823 PPNGTDPDE 831


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 597,327
Number of Sequences: 2352
Number of extensions: 11124
Number of successful extensions: 291
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 290
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 291
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74844540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)