BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0152 (732 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10510.1 68414.m01183 leucine-rich repeat family protein simi... 41 0.001 At3g63130.1 68416.m07090 RAN GTPase activating protein 1 (RanGAP... 33 0.26 At5g19320.1 68418.m02302 RAN GTPase activating protein 2 (RanGAP... 31 0.60 At2g02780.1 68415.m00221 leucine-rich repeat transmembrane prote... 29 2.4 At1g63640.2 68414.m07198 kinesin motor protein-related C-termina... 29 2.4 At1g63640.1 68414.m07197 kinesin motor protein-related C-termina... 29 2.4 At5g43400.1 68418.m05305 expressed protein strong similarity to ... 29 4.2 At1g79880.3 68414.m09332 La domain-containing protein contains P... 29 4.2 At1g79880.2 68414.m09331 La domain-containing protein contains P... 29 4.2 At1g79880.1 68414.m09333 La domain-containing protein contains P... 29 4.2 At1g10455.1 68414.m01177 hypothetical protein 29 4.2 At5g67550.1 68418.m08518 expressed protein 28 5.6 At5g25770.2 68418.m03059 expressed protein 28 5.6 At5g25770.1 68418.m03058 expressed protein 28 5.6 At4g31250.1 68417.m04436 leucine-rich repeat transmembrane prote... 28 5.6 At3g02840.1 68416.m00276 immediate-early fungal elicitor family ... 28 7.3 At5g41310.1 68418.m05020 kinesin motor protein-related 27 9.7 At4g12690.1 68417.m01993 expressed protein 27 9.7 At3g23300.1 68416.m02939 dehydration-responsive protein-related ... 27 9.7 >At1g10510.1 68414.m01183 leucine-rich repeat family protein similar to ribonuclease inhibitor (GI:164639) [Sus scrofa (pig)]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 605 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/75 (32%), Positives = 39/75 (52%) Frame = +1 Query: 265 VQQNDQKLTDLNWNNIKNISDEKFEKLFEALKSNSHVEVLSLVNVGLTDRTAGALADALR 444 V Q++ L LN + I DE + L L NS +E+L L + + D A +A+ L+ Sbjct: 221 VLQSNIMLKILNLSG-NPIGDEGAKTLCATLMENSSIEILQLNSTDIGDEGAKEIAELLK 279 Query: 445 HNTALRVLSVETNFI 489 N+ LR++ + N I Sbjct: 280 RNSTLRIIELNNNMI 294 >At3g63130.1 68416.m07090 RAN GTPase activating protein 1 (RanGAP1) contains Pfam PF00560: Leucine Rich Repeat domains; identical to RAN GTPase activating protein 1 (GI:6708466)[Arabidopsis thaliana] Length = 535 Score = 32.7 bits (71), Expect = 0.26 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 316 NISDEKFEKLFEAL-KSNSHVEVLSLVNVGLTDRTAGALADALRHNTALRVLSVETN 483 N+ DE E L EAL KS +EVL L +T ++ G LA + +L L++ N Sbjct: 360 NLEDEGTEALSEALLKSAPSLEVLELAGNDITVKSTGNLAACIASKQSLAKLNLSEN 416 >At5g19320.1 68418.m02302 RAN GTPase activating protein 2 (RanGAP2) identical to RAN GTPase activating protein 2 GI:6708468 from [Arabidopsis thaliana] Length = 545 Score = 31.5 bits (68), Expect = 0.60 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = +1 Query: 286 LTDLNWNNIKNISDEKFEKLFEAL-KSNSHVEVLSLVNVGLTDRTAGALADALRHNTALR 462 L+ LN ++ N EK + F AL KS S +E L L+N G++ A A+++ + LR Sbjct: 216 LSSLNLSD--NALGEKGVRAFGALLKSLSSLEELYLMNDGISKEAAQAVSELIPSTENLR 273 Query: 463 VLSVETN 483 VL N Sbjct: 274 VLHFHNN 280 >At2g02780.1 68415.m00221 leucine-rich repeat transmembrane protein kinase, putative Length = 753 Score = 29.5 bits (63), Expect = 2.4 Identities = 24/86 (27%), Positives = 43/86 (50%) Frame = +1 Query: 235 RHGPG*KIARVQQNDQKLTDLNWNNIKNISDEKFEKLFEALKSNSHVEVLSLVNVGLTDR 414 R P +I + + +LT + N +S F KLF L S ++ LSL ++G++ Sbjct: 63 RPSPSLRIICLHGHVTELT-VTGNRTSKLSGS-FHKLFTLLTQLSSLKTLSLTSLGISGS 120 Query: 415 TAGALADALRHNTALRVLSVETNFIS 492 + + L + +L L++ +NFIS Sbjct: 121 LSPKIITKL--SPSLESLNLSSNFIS 144 >At1g63640.2 68414.m07198 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1065 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +1 Query: 376 EVLSLVNVGLTDRTAGALADALRHNTALRVLSV 474 +VL L+N+GL +RT GA A R + + VLSV Sbjct: 646 DVLELMNIGLMNRTVGATALNERSSRSHCVLSV 678 >At1g63640.1 68414.m07197 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1064 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +1 Query: 376 EVLSLVNVGLTDRTAGALADALRHNTALRVLSV 474 +VL L+N+GL +RT GA A R + + VLSV Sbjct: 646 DVLELMNIGLMNRTVGATALNERSSRSHCVLSV 678 >At5g43400.1 68418.m05305 expressed protein strong similarity to unknown protein (emb|CAB86628.1) Length = 655 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 295 LNWNNIKNISDEKFEKLFEALKSNSHVEVLSLVNVGLTDRTAGAL 429 L +N + +++ + ++KLFE S E L V G AGAL Sbjct: 347 LKYNRVPSVAMKNYKKLFEEHDSERFTEFLEDVKSGKKKIAAGAL 391 >At1g79880.3 68414.m09332 La domain-containing protein contains Pfam profile PF05383: La domain; similar to putative protein GB:CAA18589 [Arabidopsis thaliana] Length = 357 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 268 QQNDQKLTDLNWNNIKNISDEKFEKLFEALKSNSHVE 378 + N +L WNN ++S E + LF+ S H+E Sbjct: 218 KDNTDQLVVPPWNNSNSVSSEVLKDLFQRFGSVEHIE 254 >At1g79880.2 68414.m09331 La domain-containing protein contains Pfam profile PF05383: La domain; similar to putative protein GB:CAA18589 [Arabidopsis thaliana] Length = 345 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 268 QQNDQKLTDLNWNNIKNISDEKFEKLFEALKSNSHVE 378 + N +L WNN ++S E + LF+ S H+E Sbjct: 218 KDNTDQLVVPPWNNSNSVSSEVLKDLFQRFGSVEHIE 254 >At1g79880.1 68414.m09333 La domain-containing protein contains Pfam profile PF05383: La domain; similar to putative protein GB:CAA18589 [Arabidopsis thaliana] Length = 399 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 268 QQNDQKLTDLNWNNIKNISDEKFEKLFEALKSNSHVE 378 + N +L WNN ++S E + LF+ S H+E Sbjct: 272 KDNTDQLVVPPWNNSNSVSSEVLKDLFQRFGSVEHIE 308 >At1g10455.1 68414.m01177 hypothetical protein Length = 152 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 137 HASLLNKGQPVGLGWDGITKATKPKVF 217 +A +LN G +GL WD +T+ K K F Sbjct: 102 NAKVLNTGDHIGLFWDKLTREVKFKHF 128 >At5g67550.1 68418.m08518 expressed protein Length = 439 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 642 LGLHLEYSDARHRVASHLQRNIDR 713 LGL++ +SD R RV+S +R +DR Sbjct: 85 LGLYVAFSDKRRRVSSTRRRYLDR 108 >At5g25770.2 68418.m03059 expressed protein Length = 418 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -1 Query: 684 RPCASRRCTRGAARDAAGSDSVRRAELSPSRSCYRELAISGWRPG 550 RP +RG A G DS E + ++ YR+ IS WR G Sbjct: 174 RPWLEAYASRGYV--AIGLDSRYHGERADCKTAYRDALISSWRNG 216 >At5g25770.1 68418.m03058 expressed protein Length = 360 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -1 Query: 684 RPCASRRCTRGAARDAAGSDSVRRAELSPSRSCYRELAISGWRPG 550 RP +RG A G DS E + ++ YR+ IS WR G Sbjct: 116 RPWLEAYASRGYV--AIGLDSRYHGERADCKTAYRDALISSWRNG 158 >At4g31250.1 68417.m04436 leucine-rich repeat transmembrane protein kinase, putative receptor kinase, Petunia inflata, Patchx:G498278 Length = 676 Score = 28.3 bits (60), Expect = 5.6 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Frame = -3 Query: 277 HFVALERSFIRVRVVGRVHWEYLGFSGFGDAVPSE-SDGLALVQKRRVILVLIHHRDEYE 101 HFV ++ ++ + R E LG GFG + + S G A+V KR + I + Y+ Sbjct: 350 HFVRNDQERFTLQDMLRASAEVLGSGGFGSSYKAALSSGRAVVVKRFRFMSNIGREEFYD 409 Query: 100 --QALGTASQEEIIDLAA 53 + +G S ++ L A Sbjct: 410 HMKKIGRLSHPNLLPLIA 427 >At3g02840.1 68416.m00276 immediate-early fungal elicitor family protein similar to immediate-early fungal elicitor protein CMPG1 (GI:14582200) [Petroselinum crispum] Length = 379 Score = 27.9 bits (59), Expect = 7.3 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 3/82 (3%) Frame = +1 Query: 253 KIARVQQ-NDQKLTDLNWNNIKNISDEKFEK--LFEALKSNSHVEVLSLVNVGLTDRTAG 423 KI RV Q + W KN D + + L EAL+ + ++L L+ VG D+T Sbjct: 285 KILRVSDLATQCSVSILWKLWKNKKDGECDDRLLVEALQVGAFEKLLVLLQVGCEDKTKE 344 Query: 424 ALADALRHNTALRVLSVETNFI 489 ++ LR+ R +TN + Sbjct: 345 KASELLRNLNRCRNEIEKTNCV 366 >At5g41310.1 68418.m05020 kinesin motor protein-related Length = 961 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 376 EVLSLVNVGLTDRTAGALADALRHNTALRVLSV 474 +VL L+N+GL +RT GA + + + VLSV Sbjct: 585 DVLELMNIGLMNRTVGATTLNEKSSRSHSVLSV 617 >At4g12690.1 68417.m01993 expressed protein Length = 285 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = -3 Query: 226 VHWEYLGFSGFGDAVPSESDGLALVQKRRVILVLIHHRDEYEQALGTASQEEIIDLA 56 V+W++ G PS +ALV + V+L+L H+ + + T S+ ++D A Sbjct: 97 VYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKR--TKSRPSLVDAA 151 >At3g23300.1 68416.m02939 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 611 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 35 RVESEDGRKINDLLL*CSAESLFVFISMMNQDQYHASLLNKGQPVGLGWD 184 R SE G+K ++L C A + VF+ + H + + G+ +GLG D Sbjct: 2 RGRSEGGKKKPVIVLLCVASVVLVFVYLFFGSSNHKA-IEYGRKLGLGGD 50 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,647,071 Number of Sequences: 28952 Number of extensions: 236926 Number of successful extensions: 911 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -