SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0150
         (543 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_04_0479 - 17948043-17949037,17949554-17949715,17949809-179502...    29   3.2  

>09_04_0479 -
           17948043-17949037,17949554-17949715,17949809-17950262,
           17952895-17953326
          Length = 680

 Score = 28.7 bits (61), Expect = 3.2
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = +3

Query: 207 KSYYIPIYKKGQCVRDFHNVSLLMAHCSNAYKSNDY 314
           K+ Y  I    QC+ +  N       CSN Y+ N Y
Sbjct: 254 KTSYACISNNSQCIDNLTNAQGYRCKCSNGYEGNPY 289


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,403,576
Number of Sequences: 37544
Number of extensions: 171501
Number of successful extensions: 246
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 242
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 246
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1210221432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -