BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0150 (543 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT030185-1|ABN49324.1| 388|Drosophila melanogaster IP17908p pro... 29 4.1 AE014134-2394|ABI31314.1| 1597|Drosophila melanogaster CG31731-P... 29 4.1 >BT030185-1|ABN49324.1| 388|Drosophila melanogaster IP17908p protein. Length = 388 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 527 ILKMLYLFVSLLYHYILSITSHITFGYSLAYLASAFILYVY 405 +L +LY+ ++ Y Y++SI H F + LA I Y + Sbjct: 304 VLFLLYILSTMSYAYLISICFHSVFYAKIGGLAMLIIPYAF 344 >AE014134-2394|ABI31314.1| 1597|Drosophila melanogaster CG31731-PB, isoform B protein. Length = 1597 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 527 ILKMLYLFVSLLYHYILSITSHITFGYSLAYLASAFILYVY 405 +L +LY+ ++ Y Y++SI H F + LA I Y + Sbjct: 304 VLFLLYILSTMSYAYLISICFHSVFYAKIGGLAMLIIPYAF 344 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,846,404 Number of Sequences: 53049 Number of extensions: 333018 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2074444800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -