BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0148 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces... 60 3e-10 SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 28 1.00 SPBC27B12.01c |mmm1|SPBC30B4.09c|Mdm10/Mdm12/Mmm1 complex subuni... 26 4.0 SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 26 5.3 SPAC27E2.04c |mug155||sequence orphan|Schizosaccharomyces pombe|... 25 9.3 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 25 9.3 SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces po... 25 9.3 >SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces pombe|chr 2|||Manual Length = 448 Score = 60.1 bits (139), Expect = 3e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 12 GMDEMEFTEAESNMNDLVSEYQQYQEA 92 GMDEMEFTEAESNMNDLVSEYQQYQEA Sbjct: 402 GMDEMEFTEAESNMNDLVSEYQQYQEA 428 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 28.3 bits (60), Expect = 1.00 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 293 KLPVMTNYLNEHNLFNTFLDIPPGLVE 373 K+ ++L EHN+FNTFL G+V+ Sbjct: 577 KITDCLSFLLEHNIFNTFLVYNEGIVK 603 >SPBC27B12.01c |mmm1|SPBC30B4.09c|Mdm10/Mdm12/Mmm1 complex subunit Mmm1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 346 Score = 26.2 bits (55), Expect = 4.0 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 435 CTYVNKKCLF*-ISLYKFQI*LSTRPGGISRNVLNRL 328 C +V K LF + +Y L PGG+ VLNR+ Sbjct: 209 CKFVGKVSLFTTLIVYSLYDSLHPSPGGLKHQVLNRI 245 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 25.8 bits (54), Expect = 5.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 450 ADQNSIPTNADSTQTPVPFCFVAQSV*SLDVAMNAKRL 563 AD + P + D+ + P+P V SV + D+ AKR+ Sbjct: 641 ADALTKPPSLDAVKEPIPVPSVETSVVAQDLTHKAKRI 678 >SPAC27E2.04c |mug155||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 187 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/39 (23%), Positives = 22/39 (56%) Frame = +1 Query: 430 CAAETKWRIKIRYLPTLIQRRHLCHFVLLHRVYKVWMLP 546 C + + R+K +++ +L ++ HF+ H + + +LP Sbjct: 63 CRLKIRCRLKKKFIKSLSKKIISYHFISFHTIVVLLLLP 101 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 468 VSNFDPPFCFCCTYVNKK 415 VSN PPF C TY+ K Sbjct: 3032 VSNIGPPFPNCSTYILSK 3049 >SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 646 Score = 25.0 bits (52), Expect = 9.3 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 254 VRHAF*LLTDSTTKLPVMTNYLNEHNLFNTFLD 352 + H L+D KL T +NEHN N FLD Sbjct: 67 IDHGKSTLSDCILKL---TGVINEHNFRNQFLD 96 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,364,799 Number of Sequences: 5004 Number of extensions: 44653 Number of successful extensions: 124 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -