BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0148 (642 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 4.4 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 22 5.8 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 4.4 Identities = 6/21 (28%), Positives = 11/21 (52%) Frame = -1 Query: 573 PSQLNVWRSWQHPNFIHSVQQ 511 P+ WR W+ PN + + + Sbjct: 856 PAVYEDWRHWKFPNLVEVLDE 876 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = +2 Query: 494 TCAILFCCTECIKFGCCHERQTFNCDGFSNRSFVSDDN 607 T I+ C T G + +++ + + +NR+ + DN Sbjct: 15 TITIVMCQTFTYSHGWTNGKRSTSLEELANRNAIQSDN 52 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,636 Number of Sequences: 438 Number of extensions: 3525 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -