BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0134 (447 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0458 + 23808402-23808469,23808800-23809684,23810011-238119... 27 6.9 03_06_0250 + 32645600-32646649,32647549-32647791,32648008-326482... 27 9.1 >11_06_0458 + 23808402-23808469,23808800-23809684,23810011-23811961, 23812210-23812285,23813064-23813072,23813243-23813335, 23813578-23813581,23813780-23814703,23814926-23815909, 23816073-23816118,23816376-23816951,23817253-23817798, 23817820-23818416 Length = 2252 Score = 27.1 bits (57), Expect = 6.9 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +3 Query: 189 MKYMSLDNLNIVEVFQLNLKNVWKKCYIYSNKYCKKL 299 +K + D N+V++FQL+ +KC +Y N C++L Sbjct: 1648 VKLQNSDLNNVVDLFQLSYLTESEKCNLYRN--CQEL 1682 >03_06_0250 + 32645600-32646649,32647549-32647791,32648008-32648229, 32648375-32648443,32650681-32650768,32651147-32651230, 32651494-32651582,32651933-32652046,32652513-32652647, 32652847-32653071 Length = 772 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 366 WGIY*LISFIYRPFIKFLYTKNSIF 292 +G++ ISFI PFI FL+ + S F Sbjct: 429 FGMFSKISFICVPFISFLHFEGSFF 453 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,410,005 Number of Sequences: 37544 Number of extensions: 108829 Number of successful extensions: 201 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 859680288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -