BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0134 (447 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78543-6|CAB01756.1| 2962|Caenorhabditis elegans Hypothetical pr... 29 1.2 Z78417-13|CAB01693.1| 2962|Caenorhabditis elegans Hypothetical p... 29 1.2 AF111934-1|AAD18003.1| 2962|Caenorhabditis elegans SDC-2 protein. 29 1.2 >Z78543-6|CAB01756.1| 2962|Caenorhabditis elegans Hypothetical protein C35C5.1 protein. Length = 2962 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = -1 Query: 336 YRPFIKFLYTKNSIF-YNIYWSKY--NIFSKH 250 YRPF K + T +SIF +N+Y ++ N SKH Sbjct: 2463 YRPFAKLIATYDSIFKFNVYLFEHFLNCISKH 2494 >Z78417-13|CAB01693.1| 2962|Caenorhabditis elegans Hypothetical protein C35C5.1 protein. Length = 2962 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = -1 Query: 336 YRPFIKFLYTKNSIF-YNIYWSKY--NIFSKH 250 YRPF K + T +SIF +N+Y ++ N SKH Sbjct: 2463 YRPFAKLIATYDSIFKFNVYLFEHFLNCISKH 2494 >AF111934-1|AAD18003.1| 2962|Caenorhabditis elegans SDC-2 protein. Length = 2962 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = -1 Query: 336 YRPFIKFLYTKNSIF-YNIYWSKY--NIFSKH 250 YRPF K + T +SIF +N+Y ++ N SKH Sbjct: 2463 YRPFAKLIATYDSIFKFNVYLFEHFLNCISKH 2494 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,276,983 Number of Sequences: 27780 Number of extensions: 123041 Number of successful extensions: 271 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 777938954 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -