BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0132 (682 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59570.1 68416.m06647 RabGAP/TBC domain-containing protein si... 31 0.93 At1g30170.1 68414.m03688 hypothetical protein contains Pfam prof... 29 2.2 At1g69420.2 68414.m07975 zinc finger (DHHC type) family protein ... 27 8.7 At1g69420.1 68414.m07974 zinc finger (DHHC type) family protein ... 27 8.7 >At3g59570.1 68416.m06647 RabGAP/TBC domain-containing protein similar to GTPase activating protein [Yarrowia lipolytica] GI:2370595; contains Pfam profile PF00566: TBC domain Length = 720 Score = 30.7 bits (66), Expect = 0.93 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 392 SFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIF 490 SFV + P GFP P D +F P++ D+F Sbjct: 213 SFVPPSSPYGFPSPGPFADDIFDFPSLPVTDLF 245 >At1g30170.1 68414.m03688 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 366 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +3 Query: 114 FELDWFTTKLTAGQNKIIRNSNEFVIFKEDSVPMTEIMKMLDE-GKVPLICRKSSVTCLK 290 F + W+ A +KI + F++F+E+ M D+ G + + KS C+ Sbjct: 254 FLVKWYAKGCLASSSKITYETQRFMVFREEETTEERFMCYTDDIGDLCIFVSKSEAFCVP 313 Query: 291 DS 296 S Sbjct: 314 AS 315 >At1g69420.2 68414.m07975 zinc finger (DHHC type) family protein contains Pfam profile: PF01529: DHHC zinc finger domain Length = 596 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 629 SFYIFFG-YYGCKIHQFI*I*FFGTTLDCV 543 +FY+FF + G KIHQ+I + + + CV Sbjct: 27 AFYVFFAPFVGKKIHQYIAMGIYTPLITCV 56 >At1g69420.1 68414.m07974 zinc finger (DHHC type) family protein contains Pfam profile: PF01529: DHHC zinc finger domain Length = 596 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 629 SFYIFFG-YYGCKIHQFI*I*FFGTTLDCV 543 +FY+FF + G KIHQ+I + + + CV Sbjct: 27 AFYVFFAPFVGKKIHQYIAMGIYTPLITCV 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,295,845 Number of Sequences: 28952 Number of extensions: 308389 Number of successful extensions: 754 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -