BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0127 (515 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_30676| Best HMM Match : DUF999 (HMM E-Value=6.7) 28 4.0 SB_53989| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 >SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1995 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +3 Query: 339 LVLKMICICLHFYSNNIHDNYSELKSLLVHSCLKHFKKKKTTEIIYL 479 +V+ + C+ + + +S +++V + L FK+KKTT + L Sbjct: 339 MVVTLAAKCVAHLATGLRKKFSAYSAMMVSAILDKFKEKKTTVVTAL 385 >SB_30676| Best HMM Match : DUF999 (HMM E-Value=6.7) Length = 310 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 158 VCKIFEKYLL*DNLLKRNGSRNKPLNVITLLFNVRKNYVGSTILK 24 VC++ + L D+ L + GS L +++ RK YVG K Sbjct: 99 VCRVLQLMNLTDSQLSQRGSEKLELAILSFFEQFRKIYVGDQAQK 143 >SB_53989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 275 EDYCTYSCLKFVKTKNNNI 219 EDY +C K ++TKN NI Sbjct: 15 EDYLDKNCAKIIQTKNGNI 33 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 275 EDYCTYSCLKFVKTKNNNI 219 EDY +C K ++TKN NI Sbjct: 128 EDYLDKNCAKIIQTKNGNI 146 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,609,483 Number of Sequences: 59808 Number of extensions: 246003 Number of successful extensions: 506 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -