BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0119 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 32 0.35 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 32 0.35 At5g66720.2 68418.m08411 5-azacytidine resistance protein -relat... 31 0.61 At5g66720.1 68418.m08410 5-azacytidine resistance protein -relat... 31 0.61 At5g10290.1 68418.m01194 leucine-rich repeat family protein / pr... 30 1.4 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 30 1.4 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 1.9 At4g16940.1 68417.m02555 disease resistance protein (TIR-NBS-LRR... 29 2.5 At3g21790.1 68416.m02748 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.7 At3g20020.1 68416.m02533 protein arginine N-methyltransferase fa... 28 5.7 At3g25590.1 68416.m03186 expressed protein 28 7.5 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 28 7.5 At4g21550.1 68417.m03113 transcriptional factor B3 family protei... 27 9.9 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 32.3 bits (70), Expect = 0.35 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = +3 Query: 96 MSPSNQDLE-DKLY--NSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRTPWS 266 M NQ E +KL+ NS L+ Y ++ S ++E+Q + + QNV ++DK RT + Sbjct: 288 MEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRTEQA 347 Query: 267 TATSCG 284 + S G Sbjct: 348 GSFSRG 353 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 32.3 bits (70), Expect = 0.35 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = +3 Query: 96 MSPSNQDLE-DKLY--NSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRTPWS 266 M NQ E +KL+ NS L+ Y ++ S ++E+Q + + QNV ++DK RT + Sbjct: 289 MEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRTEQA 348 Query: 267 TATSCG 284 + S G Sbjct: 349 GSFSRG 354 >At5g66720.2 68418.m08411 5-azacytidine resistance protein -related contains weak similarity to 5-azacytidine resistance protein azr1 (Swiss-Prot:Q09189) [Schizosaccharomyces pombe] Length = 411 Score = 31.5 bits (68), Expect = 0.61 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = +3 Query: 84 SADSMSPSNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRTPW 263 S D + + D LYN +TG S+VR L+ + Q I + + KR++P+ Sbjct: 324 SGDVIVAGTDGVYDNLYNEEITGVVVSSVRAGLDPKGTAQ-KIAELARQRAVDKKRQSPF 382 Query: 264 STA 272 +TA Sbjct: 383 ATA 385 >At5g66720.1 68418.m08410 5-azacytidine resistance protein -related contains weak similarity to 5-azacytidine resistance protein azr1 (Swiss-Prot:Q09189) [Schizosaccharomyces pombe] Length = 414 Score = 31.5 bits (68), Expect = 0.61 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = +3 Query: 84 SADSMSPSNQDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIIDKRRTPW 263 S D + + D LYN +TG S+VR L+ + Q I + + KR++P+ Sbjct: 327 SGDVIVAGTDGVYDNLYNEEITGVVVSSVRAGLDPKGTAQ-KIAELARQRAVDKKRQSPF 385 Query: 264 STA 272 +TA Sbjct: 386 ATA 388 >At5g10290.1 68418.m01194 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 613 Score = 30.3 bits (65), Expect = 1.4 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = +3 Query: 75 VELSADSMSPSN---QDLEDKLYNSILTGDYDSAVRKSLEYESQGQGSIVQNVVNNLIID 245 ++L+ D+ S N Q K+Y +L + AV++ ++ES G + Q V + + Sbjct: 283 LQLATDNFSEKNVLGQGGFGKVYKGVLPDNTKVAVKRLTDFESPGGDAAFQREVEMISVA 342 Query: 246 KRRTPWSTATSCGSATDRIL 305 R C + T+R+L Sbjct: 343 VHRNLLRLIGFCTTQTERLL 362 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 263 EYCYKLWVGNGQDIVKKYFPLSF 331 EY KL + +G D KYFPL+F Sbjct: 396 EYQLKLMIASGVDAANKYFPLAF 418 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +3 Query: 51 VLAASAGVVELSADSMSPSNQDLEDKLYNSILTGDYD 161 VLA + G ELS SP+ Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSP---SPAEQEIESFLYNAINMGFFD 103 >At4g16940.1 68417.m02555 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1103 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 130 SLSSRSWLEGLMLSADSSTTPALAASTHIAN 38 S+S WLEG L DS T A HIAN Sbjct: 1065 SVSFNPWLEGEALCVDSMITEQQDAQIHIAN 1095 >At3g21790.1 68416.m02748 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 495 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 302 YPVRCRPTACSSTPWCPSLVN 240 YPV+C P A ++ W P VN Sbjct: 186 YPVKCLPHALAANMWLPVFVN 206 >At3g20020.1 68416.m02533 protein arginine N-methyltransferase family protein similar to SP|Q96LA8 Protein arginine N-methyltransferase 6 (EC 2.1.1.-) {Homo sapiens} Length = 435 Score = 28.3 bits (60), Expect = 5.7 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -1 Query: 734 SRGVHDR-IELQGIVEFAVVDEEQDVVSYLAGWKNHCSLVLSALLPPYTTRSRALQ 570 + G+ D+ I L G VE +DEE DV+ ++ W + L S L T R R L+ Sbjct: 162 ANGLSDKVIVLHGRVEDVEIDEEVDVI--ISEWMGYMLLYESMLGSVITARDRWLK 215 >At3g25590.1 68416.m03186 expressed protein Length = 423 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 329 SLMGSTF*QYPVRCRPTACSSTPWCPSLVNDQIVNYILND 210 SL ST ++ R P+ S CP +ND++VN + ++ Sbjct: 18 SLYYSTPSEFTCRKHPSVSSGVGICPYCLNDRLVNLVCSE 57 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +1 Query: 481 HYLVGEQQSDFKAHNTKYNQYLKMSTSTCNCNARDRVVYGGNSADSTREQW 633 +Y + + Q+DF+AH + +Y S +T ++ YG +SA REQ+ Sbjct: 362 NYKMDQPQTDFRAHVSDQGRYACDSWNTPRDSSFSVDRYGLSSAPVEREQY 412 >At4g21550.1 68417.m03113 transcriptional factor B3 family protein low similarity to SP|Q01593 Abscisic acid-insensitive protein 3 {Arabidopsis thaliana}, SP|P37398 Viviparous protein homolog {Oryza sativa}; contains Pfam profile PF02362: B3 DNA binding domain Length = 721 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = -3 Query: 210 CCPGLGSRIPSSYVQHCRSHR*GCCCTVC---PRGLG*K-GSCC 91 C G I + +H R HR GC C +C P G+G K CC Sbjct: 545 CTEVEGLLISPTTTKHPR-HRDGCTCIICIQSPSGIGPKHDRCC 587 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,650,029 Number of Sequences: 28952 Number of extensions: 284047 Number of successful extensions: 769 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -