BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0118 (767 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ... 27 2.2 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 27 3.0 SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 27 3.0 SPBC29A10.01 |ccr1|SPBC365.17|NADPH-cytochrome p450 reductase |S... 27 3.9 SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosacch... 27 3.9 SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 26 6.8 SPCC16A11.06c |gpi10||pig-B|Schizosaccharomyces pombe|chr 3|||Ma... 26 6.8 >SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 27.5 bits (58), Expect = 2.2 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 193 SICAQSAPSFTDW-KRDASGVRKSRT*LDNFILPERTSSVRLHFRY 59 ++C + + + DW +R +SG+++ T + I ER + HF Y Sbjct: 861 ALCDKMSEIWADWVQRTSSGIQEEDTIPNEMIDEERMLDLEKHFMY 906 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 27.1 bits (57), Expect = 3.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 457 FKWVRTPAYSNDEAGDLR 510 F ++ P YS D+AGDLR Sbjct: 443 FSALKVPVYSTDDAGDLR 460 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 27.1 bits (57), Expect = 3.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 362 SWRRYKILKQSHPVKRMIRGIGAETTSTYSQ 454 S + YK L Q + VK ++ + +ET S+Y++ Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112 >SPBC29A10.01 |ccr1|SPBC365.17|NADPH-cytochrome p450 reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 26.6 bits (56), Expect = 3.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 284 IDLHVRIATVSIRVSPDFDLTR 219 +DLH+ +A V RVSPD T+ Sbjct: 404 VDLHLNLAQVLRRVSPDAPFTK 425 >SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosaccharomyces pombe|chr 2|||Manual Length = 2358 Score = 26.6 bits (56), Expect = 3.9 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 555 PQRQFCLPKLAHLAPSQISG--FIVRVSRSSHPF 460 P+R +C P+ HL P SG F++ SR PF Sbjct: 1492 PKRVYCRPEFTHLPPCIFSGADFVLIPSR-DEPF 1524 >SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 661 Score = 25.8 bits (54), Expect = 6.8 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 232 KSGETLMETVAILTCKSIVGTGYRGERLIEPSSSWFRPKFPSG 360 KSG +++T +++ L+ PSSS R + P+G Sbjct: 563 KSGAPVLDTSSLVNPTLAKSASLNNSSLLNPSSSLLRREVPAG 605 >SPCC16A11.06c |gpi10||pig-B|Schizosaccharomyces pombe|chr 3|||Manual Length = 506 Score = 25.8 bits (54), Expect = 6.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 586 LGALQLRLVHPTAPVLLTKIG 524 +G +LR V+P +P+LLT G Sbjct: 323 IGHKELRFVYPISPILLTLAG 343 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,264,007 Number of Sequences: 5004 Number of extensions: 69865 Number of successful extensions: 134 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -