BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0118 (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377... 28 9.4 06_03_0836 - 25249491-25249511,25249883-25250050,25250721-252509... 28 9.4 06_03_0099 + 16633928-16638213,16638299-16638386,16638823-166389... 28 9.4 03_05_0778 - 27638380-27639906 28 9.4 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 9.4 01_01_0784 + 6068230-6068580,6068676-6069127,6070208-6070736 28 9.4 >11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840, 3778828-3778898,3778975-3779213,3779306-3779383, 3779734-3780156,3780416-3780661,3780886-3780978, 3781480-3781527 Length = 571 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 277 KSIVGTGYRGERLIEPSSSWFRPKFPSG 360 + + GTG + PSS+WF P+ SG Sbjct: 12 RCVFGTGPLPPASLSPSSAWFDPELSSG 39 >06_03_0836 - 25249491-25249511,25249883-25250050,25250721-25250920, 25251000-25251324,25251981-25252045,25252231-25252552, 25252650-25252730 Length = 393 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 472 TPAYSNDEAGDLRRCQVGQFW*AELALWDEPNVVVR 579 T Y+N+ + C +G+FW EL ++P+V++R Sbjct: 168 TETYTNNHQNAIIVCPLGKFWRVELQR-EQPDVLLR 202 >06_03_0099 + 16633928-16638213,16638299-16638386,16638823-16638950, 16640008-16640278 Length = 1590 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -2 Query: 703 GWLLRQVSRCTLLSGFRL---PWPPSCCHER 620 G+LLR + LLS RL P PP CCH R Sbjct: 63 GYLLRHSAHFLLLSA-RLRPPPPPPRCCHRR 92 >03_05_0778 - 27638380-27639906 Length = 508 Score = 27.9 bits (59), Expect = 9.4 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 617 NAFHGVP*AFFRRLTTTFGSSHSASSAYQNWPTWHRLRS 501 NAF G+P +FFR + S S + + W W L S Sbjct: 132 NAFSGLPHSFFRGMPELHYFSISDNPRLEEWGLWSDLLS 170 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 9.4 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 458 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 297 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 >01_01_0784 + 6068230-6068580,6068676-6069127,6070208-6070736 Length = 443 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 537 SRTGA-VG*TKRSCKAPKKRSWDTMKGVGRS*QQDGG 644 SR G + K++C APKKR+ + GV R+ GG Sbjct: 398 SRAGVTIKRAKQNCSAPKKRTMGAVLGVPRTGALGGG 434 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,072,142 Number of Sequences: 37544 Number of extensions: 502945 Number of successful extensions: 1032 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1032 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -