BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0118 (767 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 73 3e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 52 5e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 47 1e-05 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 45 8e-05 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.083 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 33 0.25 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 4.1 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.9 bits (171), Expect = 3e-13 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = +2 Query: 629 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 46 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.9 bits (171), Expect = 3e-13 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = +2 Query: 629 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 46 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.9 bits (171), Expect = 3e-13 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = +2 Query: 629 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 125 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 57.6 bits (133), Expect = 1e-08 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +2 Query: 629 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 46 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +2 Query: 650 KSESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 K ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 47 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +2 Query: 650 KSESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 K ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/39 (66%), Positives = 28/39 (71%) Frame = +2 Query: 650 KSESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 K ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +2 Query: 656 ESAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 ESAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 46 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +2 Query: 659 SAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 SAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +2 Query: 659 SAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 SAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +2 Query: 659 SAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 SAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +2 Query: 659 SAKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 SAKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 40 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 662 AKECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 AKEC TTHLPKQ ALKMDGA+A LY V +L Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAVGADAKL 73 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 576 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 668 + +RS D KGVG S QQDGGHGS NP + Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +3 Query: 576 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 683 + +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -1 Query: 566 FGSSHSASSAYQNWPTWHRLRSPASSFE*AGVLTHLKFENR 444 FGSS ASS YQN PT R+ P + + G+LT+LKFENR Sbjct: 78 FGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFENR 117 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 42.7 bits (96), Expect = 3e-04 Identities = 33/73 (45%), Positives = 35/73 (47%) Frame = -1 Query: 737 IGKTLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLTTTFGS 558 IG TL+RHPFSGLVASA + PT F G L FGS Sbjct: 24 IGATLERHPFSGLVASAEQ--------PT------------PFVGSDERRLWHLNRAFGS 63 Query: 557 SHSASSAYQNWPT 519 S ASSAYQ WPT Sbjct: 64 SRIASSAYQKWPT 76 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 42.7 bits (96), Expect = 3e-04 Identities = 33/73 (45%), Positives = 35/73 (47%) Frame = -1 Query: 737 IGKTLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLTTTFGS 558 IG TL+RHPFSGLVASA + PT F G L FGS Sbjct: 22 IGATLERHPFSGLVASAEQ--------PT------------PFVGSDERRLWHLNRAFGS 61 Query: 557 SHSASSAYQNWPT 519 S ASSAYQ WPT Sbjct: 62 SRIASSAYQKWPT 74 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = +2 Query: 665 KECATTHLPKQPALKMDGAEAFCLYTTVTGTCEL 766 KEC TT LPKQ ALKMDGA+A LY V +L Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAVGADAKL 73 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +3 Query: 576 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 668 + +RS D KGVG S QQDGGHGS NPL+ Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +1 Query: 589 NAHGTP*KALVAHDSRTVAMEVGIR 663 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +2 Query: 650 KSESAKECATTHLPKQPALKM 712 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 253 PSGFPLTST*PGIVHHLSGPSICA 182 P FPL S GIVHHLSGP+ CA Sbjct: 6 PPEFPLASPYSGIVHHLSGPNRCA 29 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 35.1 bits (77), Expect = 0.063 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 254 SIRVSPDFDLTRHSSPSFGSQHLCS 180 S RVS F L RHSSPSFGSQ + S Sbjct: 40 STRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 34.7 bits (76), Expect = 0.083 Identities = 17/29 (58%), Positives = 18/29 (62%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPTWHRLRSPAS 492 L FGSS ASSAYQN P R+ PAS Sbjct: 17 LNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/32 (56%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT--WHRLRSPASS 489 L FGSS ASSAYQ WPT H L P S Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLGDPLES 48 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 54 LNRAFGSSRIASSAYQKWPT 73 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 55 LNRAFGSSRIASSAYQKWPT 74 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 96 LNRAFGSSRIASSAYQKWPT 115 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 139 LNRAFGSSRIASSAYQKWPT 158 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 317 ISLSPLYPVPTIDLHVR 267 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ WPT Sbjct: 17 LNHAFGSSRIASSAYQKWPT 36 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 0.59 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L +GSS ASSAYQ WPT Sbjct: 17 LNRAYGSSRIASSAYQKWPT 36 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSA Q WPT Sbjct: 74 LNRAFGSSRIASSALQKWPT 93 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 681 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 586 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 578 LTTTFGSSHSASSAYQNWPT 519 L FGSS ASSAYQ PT Sbjct: 17 LNRAFGSSRIASSAYQKGPT 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,902,665 Number of Sequences: 59808 Number of extensions: 542904 Number of successful extensions: 1361 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 1211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1359 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -