BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0118 (767 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05570.1 68418.m00605 transducin family protein / WD-40 repea... 28 7.9 At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat... 28 7.9 At2g35890.1 68415.m04406 calcium-dependent protein kinase, putat... 28 7.9 At2g27810.2 68415.m03372 xanthine/uracil permease family protein... 28 7.9 At2g27810.1 68415.m03371 xanthine/uracil permease family protein... 28 7.9 >At5g05570.1 68418.m00605 transducin family protein / WD-40 repeat family protein similar to unknown protein (pir||T04661); contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 2 weak)|8683726|gb|AV524198.1|AV524198 Length = 1124 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 3/28 (10%) Frame = -1 Query: 326 DGSISLSPL-YP--VPTIDLHVRIATVS 252 + IS+SPL YP VPT+D H+ +AT S Sbjct: 414 ENKISVSPLPYPMVVPTMDPHMTVATFS 441 >At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative similar to mitogen-activated protein kinase [Arabidopsis thaliana] gi|1255448|dbj|BAA09057; contains Pfam PF00069: Protein kinase domain Length = 773 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/69 (23%), Positives = 29/69 (42%) Frame = -1 Query: 383 KFYIDASYPEGNFGRNQLLDGSISLSPLYPVPTIDLHVRIATVSIRVSPDFDLTRHSSPS 204 K +D+ E G + + P+ +P +DL + +PD ++ R S S Sbjct: 375 KEVVDSGTVENRRGIKGVRPSVLKPPPVMKLPPVDLPGSSWDILTHFAPDSEIVRRPSSS 434 Query: 203 FGSQHLCSE 177 S++ C E Sbjct: 435 SSSENGCDE 443 >At2g35890.1 68415.m04406 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK). [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 520 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 626 MTAGRWPWKSESAKECATTHLPKQPALKMDGAEAFC 733 +T+ WP SESAK+ L + P ++ + C Sbjct: 351 LTSDPWPQVSESAKDLIRKMLERNPIQRLTAQQVLC 386 >At2g27810.2 68415.m03372 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 660 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 582 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 683 P KR D+ VGRS DG +GS +P+R R+ Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147 >At2g27810.1 68415.m03371 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 709 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 582 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 683 P KR D+ VGRS DG +GS +P+R R+ Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,352,255 Number of Sequences: 28952 Number of extensions: 382666 Number of successful extensions: 827 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -