BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0117 (645 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110485-26|CAB60359.3| 779|Caenorhabditis elegans Hypothetical... 27 8.6 >AL110485-26|CAB60359.3| 779|Caenorhabditis elegans Hypothetical protein Y46G5A.17 protein. Length = 779 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +2 Query: 425 FAKRWIVHPSKGNVSWD*TVVRQVSFTL*WLVFAIVILLSTRGTAVSDIWFMHSAERPVV 604 F + +IVH G+ ++ V+ L WL+F ++ LS + W S +PV Sbjct: 86 FIQNYIVHYIFGDGYLGQSISIAVAGALLWLIFVQLLRLSIKTLLEYKGWMYESPGKPVS 145 Query: 605 RTT 613 + T Sbjct: 146 KAT 148 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,274,853 Number of Sequences: 27780 Number of extensions: 324249 Number of successful extensions: 824 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -