BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0117 (645 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 24 1.4 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 3.3 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 4.4 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = -3 Query: 226 CPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAG 95 C +P S+ + L+ + + + Q NSP + P H+G Sbjct: 30 CTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 440 SNAWRICFAMIGRADIEGSK 381 S WR+C A+ R + E S+ Sbjct: 101 SGLWRVCVAISSRMEYECSR 120 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 606 RTTGRSAECMNQMSETAVPLVLSS 535 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,457 Number of Sequences: 438 Number of extensions: 4158 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -