BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0117 (645 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 3.5 At3g62370.1 68416.m07006 expressed protein 28 6.1 At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / halo... 27 8.1 At3g61130.1 68416.m06841 glycosyl transferase family 8 protein c... 27 8.1 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -3 Query: 151 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 35 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 136 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 41 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 >At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase familiy protein similar to SP|O14072 Cation-transporting ATPase 4 (EC 3.6.3.-) {Schizosaccharomyces pombe}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00702: haloacid dehalogenase-like hydrolase Length = 1179 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -3 Query: 286 IDRPCFRSPYATEHLDQASFCPFAPREVSVLAELALGHLRYSLTD 152 +D CF +DQA C P + S E+ H R +TD Sbjct: 73 VDFKCFVQFSKVNSIDQADACKVTPAKFSGSKEVVPLHFRSQMTD 117 >At3g61130.1 68416.m06841 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 673 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 574 PNVRNCGSSRTEQYYYRKDKPS*GKTNLSH 485 P +R S+ +YY++ D P+ G +NL + Sbjct: 439 PVLRQLESAAMREYYFKADHPTSGSSNLKY 468 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,653,019 Number of Sequences: 28952 Number of extensions: 311140 Number of successful extensions: 810 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -