BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0116 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 24 1.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 5.2 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = -1 Query: 226 CPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAG 95 C +P S+ + L+ + + + Q NSP + P H+G Sbjct: 30 CTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 492 LSHDGLIPAHVPF*WVNNPTLGEFVRNDRKSRH 394 +SH + HVP W+ PT RN + H Sbjct: 694 VSHTQRLVVHVPPRWIVEPTDVSVERNKHVALH 726 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 605 RTTGRSAECMNQMSETAVPLVLSS 534 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,694 Number of Sequences: 438 Number of extensions: 4876 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -