BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0114 (666 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.60 SPBC354.05c |sre2||membrane-tethered transcription factor |Schiz... 27 1.8 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 27 2.4 SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc... 26 5.6 SPCC126.15c |sec65||signal recognition particle subunit Sec65 |S... 26 5.6 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 7.4 SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1||... 25 7.4 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.60 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 349 SGCGRCRVWSMFVRYVRFSE 408 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPBC354.05c |sre2||membrane-tethered transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 793 Score = 27.5 bits (58), Expect = 1.8 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = -3 Query: 337 PDTPRSSEPILIPKLRIQFADFPYLHYSSTRGSSPWRPAADMGTNRRDISTYIPHLNF 164 P RSS I P + F D P+ +S + SS RP + + D IPH NF Sbjct: 550 PILKRSS--IGTPSQQAYFPDAPHNCHSVPQNSSYPRPPMQVNRSPIDSMQTIPHANF 605 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 27.1 bits (57), Expect = 2.4 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -3 Query: 220 ADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISL 92 A GT++ +IST +P P++VSGH A R+P+ S+ Sbjct: 371 ATNGTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412 >SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1014 Score = 25.8 bits (54), Expect = 5.6 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -2 Query: 368 RHRPHPLPVQTRHAPV-LRANPYSEVTDPICRLPLPTLFID*RLFTLETCCGYGYEPAR 195 RH P++T P+ + P E+ I R P L +L + CC YG P + Sbjct: 478 RHIKDQRPLKTGEGPIAIIMTPTRELAVQIFRECKPFL----KLLNIRACCAYGGAPIK 532 >SPCC126.15c |sec65||signal recognition particle subunit Sec65 |Schizosaccharomyces pombe|chr 3|||Manual Length = 199 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 434 QKLYIFNMTLAKIVLRFGLDPDPRSRPSADLPSR 535 QK Y+ N ++LR + DP S P ++P+R Sbjct: 74 QKKYVINEIAKVLLLRPTVKTDPLSLPIQNVPAR 107 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 7.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 386 TNIDQTRHRPHPLPVQTRHAPV 321 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1158 Score = 25.4 bits (53), Expect = 7.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 295 LRIQFADFPYLHYSSTRGSSPWRPAADMGTNRRDISTYIP 176 L ++ Y+ S +RGS P RP++ + TN I+ P Sbjct: 722 LPLELLSISYIEDSPSRGSLPRRPSSALLTNPISITKSNP 761 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,769,901 Number of Sequences: 5004 Number of extensions: 57845 Number of successful extensions: 152 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -