BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0113 (670 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyc... 25 7.5 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 25 9.9 SPBC646.13 |sds23|psp1, moc1|inducer of sexual development Sds23... 25 9.9 SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharo... 25 9.9 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 9.9 >SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 25.4 bits (53), Expect = 7.5 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = -1 Query: 577 ARGARKVTTGITGLWQPSVHSDVLFDPSMSALPIIAKQNSPSVGLFTHQKGT*AGFRPS* 398 A GAR T IT Q S S V +P+ S + N+P+ + + T + F Sbjct: 145 ASGARTQRTSITNDPQSSQSSSVSRNPASSRAGSPTRDNAPAASPASSEPRTFSSFEDQY 204 Query: 397 DRL 389 RL Sbjct: 205 GRL 207 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 25.0 bits (52), Expect = 9.9 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -2 Query: 162 DFTSR-----VSHSKRETRRRSPFGSRRSMLSVFFLTRASRLRRSG 40 DF+SR + + RRR P SRR + RA ++R SG Sbjct: 5 DFSSRSLFLEAKEEEYKQRRRVPLDSRRRVRRACLSCRAKKIRCSG 50 >SPBC646.13 |sds23|psp1, moc1|inducer of sexual development Sds23/Moc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 408 Score = 25.0 bits (52), Expect = 9.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 517 SDVLFDPSMSALPIIAKQNSPSV 449 S +L D +SALPI+A + S + Sbjct: 68 SSILIDRDLSALPIVAAKGSNEI 90 >SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 25.0 bits (52), Expect = 9.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 311 PNVRNCGSSRTEQYYYRNDKPSVG 382 P V N GSSRT+ +Y R + G Sbjct: 86 PRVINLGSSRTDWFYERKKFKNAG 109 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.0 bits (52), Expect = 9.9 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 557 NFSGTSC*KLFILKDR*AVLSQSL 628 N G S KLFI+KD V+SQ L Sbjct: 3491 NIGGRSPQKLFIVKDSGQVMSQDL 3514 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,746,918 Number of Sequences: 5004 Number of extensions: 54211 Number of successful extensions: 129 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -