BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0112 (672 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC112922-1|AAI12923.1| 218|Homo sapiens SCN1B protein protein. 31 5.0 U12193-1|AAB97608.1| 218|Homo sapiens voltage-gated sodium chan... 30 6.6 L16242-1|AAA61277.1| 218|Homo sapiens voltage-gated sodium chan... 30 6.6 L10338-1|AAA60391.1| 218|Homo sapiens sodium channel beta-1 sub... 30 6.6 DQ677665-1|ABQ01236.1| 218|Homo sapiens sodium channel beta-1 s... 30 6.6 BT019923-1|AAV38726.1| 218|Homo sapiens sodium channel, voltage... 30 6.6 BC067122-1|AAH67122.1| 218|Homo sapiens sodium channel, voltage... 30 6.6 BC021266-1|AAH21266.2| 186|Homo sapiens SCN1B protein protein. 30 6.6 >BC112922-1|AAI12923.1| 218|Homo sapiens SCN1B protein protein. Length = 218 Score = 30.7 bits (66), Expect = 5.0 Identities = 11/58 (18%), Positives = 29/58 (50%) Frame = +1 Query: 37 SAEYNKQLYDSVISGDYDHAASIAKRLHTNNVSELQETISKLISDKIRNLVDFSYRLW 210 S +Y +Y + +Y+H S+ K++H V + ++ ++S+ + ++ +W Sbjct: 116 SGDYECHVYRLLFFDNYEHNTSVVKKIHLEVVDKANRDMASIVSEIMMYVLIVVLTIW 173 >U12193-1|AAB97608.1| 218|Homo sapiens voltage-gated sodium channel beta-1 subunit protein. Length = 218 Score = 30.3 bits (65), Expect = 6.6 Identities = 11/58 (18%), Positives = 29/58 (50%) Frame = +1 Query: 37 SAEYNKQLYDSVISGDYDHAASIAKRLHTNNVSELQETISKLISDKIRNLVDFSYRLW 210 S +Y +Y + +Y+H S+ K++H V + ++ ++S+ + ++ +W Sbjct: 116 SGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIW 173 >L16242-1|AAA61277.1| 218|Homo sapiens voltage-gated sodium channel type I, beta subunit protein. Length = 218 Score = 30.3 bits (65), Expect = 6.6 Identities = 11/58 (18%), Positives = 29/58 (50%) Frame = +1 Query: 37 SAEYNKQLYDSVISGDYDHAASIAKRLHTNNVSELQETISKLISDKIRNLVDFSYRLW 210 S +Y +Y + +Y+H S+ K++H V + ++ ++S+ + ++ +W Sbjct: 116 SGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIW 173 >L10338-1|AAA60391.1| 218|Homo sapiens sodium channel beta-1 subunit protein. Length = 218 Score = 30.3 bits (65), Expect = 6.6 Identities = 11/58 (18%), Positives = 29/58 (50%) Frame = +1 Query: 37 SAEYNKQLYDSVISGDYDHAASIAKRLHTNNVSELQETISKLISDKIRNLVDFSYRLW 210 S +Y +Y + +Y+H S+ K++H V + ++ ++S+ + ++ +W Sbjct: 116 SGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIW 173 >DQ677665-1|ABQ01236.1| 218|Homo sapiens sodium channel beta-1 subunit precursor protein. Length = 218 Score = 30.3 bits (65), Expect = 6.6 Identities = 11/58 (18%), Positives = 29/58 (50%) Frame = +1 Query: 37 SAEYNKQLYDSVISGDYDHAASIAKRLHTNNVSELQETISKLISDKIRNLVDFSYRLW 210 S +Y +Y + +Y+H S+ K++H V + ++ ++S+ + ++ +W Sbjct: 116 SGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIW 173 >BT019923-1|AAV38726.1| 218|Homo sapiens sodium channel, voltage-gated, type I, beta protein. Length = 218 Score = 30.3 bits (65), Expect = 6.6 Identities = 11/58 (18%), Positives = 29/58 (50%) Frame = +1 Query: 37 SAEYNKQLYDSVISGDYDHAASIAKRLHTNNVSELQETISKLISDKIRNLVDFSYRLW 210 S +Y +Y + +Y+H S+ K++H V + ++ ++S+ + ++ +W Sbjct: 116 SGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIW 173 >BC067122-1|AAH67122.1| 218|Homo sapiens sodium channel, voltage-gated, type I, beta protein. Length = 218 Score = 30.3 bits (65), Expect = 6.6 Identities = 11/58 (18%), Positives = 29/58 (50%) Frame = +1 Query: 37 SAEYNKQLYDSVISGDYDHAASIAKRLHTNNVSELQETISKLISDKIRNLVDFSYRLW 210 S +Y +Y + +Y+H S+ K++H V + ++ ++S+ + ++ +W Sbjct: 116 SGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIW 173 >BC021266-1|AAH21266.2| 186|Homo sapiens SCN1B protein protein. Length = 186 Score = 30.3 bits (65), Expect = 6.6 Identities = 11/58 (18%), Positives = 29/58 (50%) Frame = +1 Query: 37 SAEYNKQLYDSVISGDYDHAASIAKRLHTNNVSELQETISKLISDKIRNLVDFSYRLW 210 S +Y +Y + +Y+H S+ K++H V + ++ ++S+ + ++ +W Sbjct: 84 SGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIW 141 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,561,329 Number of Sequences: 237096 Number of extensions: 1791875 Number of successful extensions: 7380 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 7255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7380 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7647512560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -