BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0111 (655 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 24 1.3 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 23 1.7 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 1.7 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 22 5.1 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 440 FLFLNNYYWCFILTKKRS*FFRLLQLK 360 F+F+N ++W IL + F R++ LK Sbjct: 99 FIFVNVFFWVIILMSNYA-FTRIILLK 124 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.4 bits (48), Expect = 1.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 237 LMNL*FN*LINWYTVFDSLYNLLQF 163 ++NL N LI+WYTV N QF Sbjct: 8 IVNLGLNGLIDWYTVCLVPLNPYQF 32 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 209 LIGTQFLTVYIIYCNLLILYC 147 L+G ++T+YII N YC Sbjct: 228 LLGDLYVTLYIILTNNQAKYC 248 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 191 LTVYIIYCNLLILYC 147 L +Y YC L+IL C Sbjct: 283 LCIYYFYCALIILLC 297 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 13 LPCIWYYKNYIAFYRINLV 69 LPCI+Y+ + + I+L+ Sbjct: 209 LPCIYYFYSAFIIFTIHLL 227 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 173 KLYKLSKTVYQLIN*LNYKFISDWKGEVSFILKFL*KY 286 KL K+ V L++ + +F G+VS +LKF+ KY Sbjct: 54 KLSKIPNNV-NLMDVVAREFDKIQVGDVSSVLKFIRKY 90 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,422 Number of Sequences: 336 Number of extensions: 2734 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -