BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0111 (655 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81061-4|CAB02932.1| 234|Caenorhabditis elegans Hypothetical pr... 29 2.2 Z82280-7|CAB05268.3| 304|Caenorhabditis elegans Hypothetical pr... 28 5.0 >Z81061-4|CAB02932.1| 234|Caenorhabditis elegans Hypothetical protein F14H8.5 protein. Length = 234 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -2 Query: 423 LLLVFYFNKE-TKLILQTFTIENQFATKYTTSEILSYYECF*S*ILK 286 L ++ Y NKE +K +LQ+ + +F T + +++ +YE S ILK Sbjct: 149 LTIIIYLNKERSKTLLQSVMMHTEFQT-HQAEKLVEHYEATFSPILK 194 >Z82280-7|CAB05268.3| 304|Caenorhabditis elegans Hypothetical protein R05A10.7 protein. Length = 304 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/47 (25%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = +1 Query: 16 PCIWYYKNYIAFYRINLVNCMYDEV----IDSCYTTIS*NILAIVSS 144 P +W+ +++ + N++ MYD++ ++S Y++I ++LA S+ Sbjct: 145 PVVWWIDSHLVTIKPNIIRNMYDDISTNRLNSNYSSIVSSVLAFHSN 191 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,291,917 Number of Sequences: 27780 Number of extensions: 221342 Number of successful extensions: 515 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -