BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0107 (661 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 24 4.9 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 4.9 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 4.9 AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse t... 23 6.5 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 6.5 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 6.5 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 8.5 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 8.5 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 8.5 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 23 8.5 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 518 ISAGARCFVPSVQSGDVAET 577 ISAG CFV Q G++A+T Sbjct: 360 ISAGKFCFVDIEQFGNMAKT 379 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 4.9 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -1 Query: 631 PPGSVLEP-DHAGVLNGD 581 PPGS+L+P D A V+ G+ Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 4.9 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 253 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 143 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 >AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse transcriptase protein. Length = 131 Score = 23.4 bits (48), Expect = 6.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 286 SLIHSCASLISDEAFGYLKRVIVT 215 SL++ C SLIS G+ R VT Sbjct: 22 SLLNCCRSLISTRQHGFFPRRSVT 45 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 652 VPPQSNSPPGSVLEPD 605 +PP SNS P S PD Sbjct: 868 MPPSSNSSPSSYPSPD 883 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 6.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 60 PLNGGRTESCRSRTKRNR 7 P +GGR SCRS R R Sbjct: 262 PRSGGRWPSCRSPPARRR 279 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 8.5 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -1 Query: 286 SLIHSCASLISDEAFGYL 233 +++HSC+S IS + G++ Sbjct: 566 TILHSCSSAISPKQHGFM 583 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.0 bits (47), Expect = 8.5 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +3 Query: 252 SLISDAHEWINEIPTVPIYYLAKPQP 329 S +SD E ++ +P++P+ +P P Sbjct: 352 SPVSDRSESVSPVPSLPVRSSPEPSP 377 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.0 bits (47), Expect = 8.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 431 DRFARSSLKNHYFHCFITYSVGRKRC 508 DRFA ++ + H F+ + G + C Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 23.0 bits (47), Expect = 8.5 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 76 HGQGESDCLI-KTKHCDGPRGC*RNVISAQC 165 +GQ ++D L+ + ++ DGP C R+ QC Sbjct: 95 YGQEKADELVARCRNNDGPDACERSFRLLQC 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,108 Number of Sequences: 2352 Number of extensions: 15244 Number of successful extensions: 39 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -