BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0106 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 26 1.2 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 4.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 4.8 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 6.3 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 23 8.3 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 224 SQMPRHLISDGMNGLTRFPLSLSTI*RN 307 S + RHL+SD + R PL++ + RN Sbjct: 1002 STIARHLLSDQSDPFNRSPLTMEQVKRN 1029 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -3 Query: 616 PPGSVLEP-DHAGVLNGD 566 PPGS+L+P D A V+ G+ Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 4.8 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 239 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 129 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 637 VPPQSNSPPGSVLEPD 590 +PP SNS P S PD Sbjct: 868 MPPSSNSSPSSYPSPD 883 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 23.0 bits (47), Expect = 8.3 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 62 HGQGESDCLI-KTKHCDGPRGC*RNVISAQC 151 +GQ ++D L+ + ++ DGP C R+ QC Sbjct: 95 YGQEKADELVARCRNNDGPDACERSFRLLQC 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 691,329 Number of Sequences: 2352 Number of extensions: 14775 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -