BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0104 (670 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 31 0.11 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.61 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 27 3.2 SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosa... 26 5.6 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 5.6 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 7.5 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 7.5 SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity prote... 25 7.5 SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 25 7.5 SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac... 25 9.9 SPCC777.02 |||transcription factor |Schizosaccharomyces pombe|ch... 25 9.9 SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces... 25 9.9 SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon... 25 9.9 SPBC16E9.06c |uvi31||BolA domain UV inducedv protein Uvi31|Schiz... 25 9.9 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 31.5 bits (68), Expect = 0.11 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 438 SGCGRCRVWSMFVRYVRFSELVFYIMRPQKLYIF 539 +GCG+ VW +VR+V F E LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.61 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 621 ARKIRGRPENAGPDPVRNVRRFSRV 547 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 26.6 bits (56), Expect = 3.2 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 165 PWNPIEGRYGSEREEHRICGGVRILSADLEIQVRDVRGDVAP 290 P+ P+EG Y + ++ HRI R A LE ++R V+ P Sbjct: 3 PYEPVEGLYVNAKQYHRILKR-REARAKLEERLRGVQTTKKP 43 >SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosaccharomyces pombe|chr 2|||Manual Length = 352 Score = 25.8 bits (54), Expect = 5.6 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -3 Query: 278 STYIPHLNFKVRREYPDTAANAVLFAFRTISPFYRIPWNSNAQA 147 STY P L V D N F I+P+Y WN A A Sbjct: 257 STYWPALAAPVYPSMKDVPNNPFT-PFSPINPYYAKSWNHTASA 299 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 5.6 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 217 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 80 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 7.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 475 TNIDQTRHRPHPLPVQTRHAPV 410 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 7.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 363 FPYLHYSID*RLFTLETCCGYGYEPARHL 277 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity protein kinase Mph1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 25.4 bits (53), Expect = 7.5 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -2 Query: 264 SPEFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRRLQA 103 +P + P VSGH LR+ IS SM +ERS R ++ + + Sbjct: 611 TPLAKKPLPVSGHTNNAHPLRLSTEISASQLSMIIERSVELSKHKRLNKELIDS 664 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 25.4 bits (53), Expect = 7.5 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 6/80 (7%) Frame = -1 Query: 445 HPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALH-----LGDLLRIWVRTGAT 281 HP ++ R+ P+ N Y+ + + L + L + + +G ++ ++V +G+T Sbjct: 254 HPFYMEQRYIPIGTTNTYTSASHGVLMLSSNGMEVLLRSTYIKYRMIGGIIDLFVYSGST 313 Query: 280 -SPRTSLT*ISRSAESIRTP 224 SP+ + I + +SI TP Sbjct: 314 VSPKYT---IQQYVQSIGTP 330 >SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 842 Score = 25.0 bits (52), Expect = 9.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 76 RVFDGVTQSGLKTPPRGPGRV 138 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 >SPCC777.02 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 632 Score = 25.0 bits (52), Expect = 9.9 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = +3 Query: 12 PVPIPEPGSGTVSIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFCLSVRVPW 170 PV + G TV+ P+S+ + +P+ P A+ + CL + W Sbjct: 132 PVSLEVRGRNTVTFYGPTSIFGTSFTSSPRPPPSASIEDTYPIIHCLQLFFKW 184 >SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 967 Score = 25.0 bits (52), Expect = 9.9 Identities = 21/70 (30%), Positives = 33/70 (47%) Frame = -3 Query: 377 SNLPTSLTYIILSTRGSSPWRPAADMGTNRRDISTYIPHLNFKVRREYPDTAANAVLFAF 198 S TSL+ R S+P R D G+++ +TYIPH K ++ +A Sbjct: 212 SEKDTSLSRRSSRGRSSAPKR-RKDSGSSKTT-ATYIPHNPSKKSSQHLPLLPDASFELE 269 Query: 197 RTISPFYRIP 168 R++S Y+ P Sbjct: 270 RSVSRSYQSP 279 >SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elongation factor 2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 25.0 bits (52), Expect = 9.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 76 RVFDGVTQSGLKTPPRGPGRV 138 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 >SPBC16E9.06c |uvi31||BolA domain UV inducedv protein Uvi31|Schizosaccharomyces pombe|chr 2|||Manual Length = 102 Score = 25.0 bits (52), Expect = 9.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 264 SPEFQGPQRVSGHRRKCGALR 202 SPEF G RV+ HR G L+ Sbjct: 60 SPEFSGMSRVARHRLVYGLLK 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,924,310 Number of Sequences: 5004 Number of extensions: 62602 Number of successful extensions: 183 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -