BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0100 (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 31 0.011 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 31 0.011 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 31 0.011 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 3.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.2 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 30.7 bits (66), Expect = 0.011 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 523 PTPSCRWYHHVPRYRRQDAEGDHRPR 446 PT SC Y H+ RY+ + +GD R R Sbjct: 152 PTNSCMEYQHLHRYKEEALQGDGRMR 177 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 30.7 bits (66), Expect = 0.011 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 523 PTPSCRWYHHVPRYRRQDAEGDHRPR 446 PT SC Y H+ RY+ + +GD R R Sbjct: 152 PTNSCMEYQHLHRYKEEALQGDGRMR 177 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 30.7 bits (66), Expect = 0.011 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 523 PTPSCRWYHHVPRYRRQDAEGDHRPR 446 PT SC Y H+ RY+ + +GD R R Sbjct: 152 PTNSCMEYQHLHRYKEEALQGDGRMR 177 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 523 PTPSCRWYHHVPRYRRQDA 467 P+PS RWY V R+ A Sbjct: 260 PSPSFRWYKFVEGTTRKQA 278 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 483 YRGTWWYHRHDGVGVQVLTDVDVALHDGVVHG 578 Y W ++R GVG + +D+D L +V+G Sbjct: 1828 YFTNWAWYRQ-GVGKYLPSDIDPDLCTHIVYG 1858 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 135 FYINLISFLFLLYTRDRCGSQRQM 64 FY N+I LF + C S Q+ Sbjct: 947 FYYNIIPILFFMLVCFTCKSNIQL 970 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 135 FYINLISFLFLLYTRDRCGSQRQM 64 FY N+I LF + C S Q+ Sbjct: 947 FYYNIIPILFFMLVCFTCKSNIQL 970 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 135 FYINLISFLFLLYTRDRCGSQRQM 64 FY N+I LF + C S Q+ Sbjct: 947 FYYNIIPILFFMLVCFTCKSNIQL 970 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 135 FYINLISFLFLLYTRDRCGSQRQM 64 FY N+I LF + C S Q+ Sbjct: 947 FYYNIIPILFFMLVCFTCKSNIQL 970 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,429 Number of Sequences: 336 Number of extensions: 2853 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -