BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0098 (633 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 4.3 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 5.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.5 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 7.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 9.9 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 250 SSLKNHYFHCFITYSVGRK 194 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 554 QHPRRPSQCFVLIRQSDSPCPCQ 622 + P RPS C + ++SP C+ Sbjct: 4 KQPNRPSYCTWELNATNSPHTCR 26 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 275 ATPLMSPYNARLESSSTGSSFP 340 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 7.5 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +2 Query: 200 PNRVSNETMKVVVFQRRSPKR---SPTYATPLMSPYNARLESSSTGSSFPADSP 352 P +++N+ ++ ++ KR SP TP+ + Y +E+ + S F D+P Sbjct: 4 PQKLANKFYRISPQILKNDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 344 QRGKKTLLSLTLVWHCKE 291 + G KTLLS T +W ++ Sbjct: 231 KNGMKTLLSETDIWEVEQ 248 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,943 Number of Sequences: 438 Number of extensions: 4080 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -