BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0096 (830 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 31 0.15 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.81 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 27 4.3 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 27 4.3 SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosa... 26 7.5 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 7.5 SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccha... 26 7.5 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 10.0 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 10.0 SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity prote... 25 10.0 SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 25 10.0 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 31.5 bits (68), Expect = 0.15 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 439 SGCGRCRVWSMFVRYVRFSELVFYIMRPQKLYIF 540 +GCG+ VW +VR+V F E LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.81 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 622 ARKIRGRPENAGPDPVRNVRRFSRV 548 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 26.6 bits (56), Expect = 4.3 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 166 PWNPIEGRYGSEREEHRICGGVRILSADLEIQVRDVRGDVAP 291 P+ P+EG Y + ++ HRI R A LE ++R V+ P Sbjct: 3 PYEPVEGLYVNAKQYHRILKR-REARAKLEERLRGVQTTKKP 43 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 26.6 bits (56), Expect = 4.3 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 636 RHDLRLG-RSAEGRRTRVRIQSET*DDFRECHIKYIQFLRPHYIKY*LAKTNITHE 472 + D +LG + A + +V + S+ D +E H+KY+Q + ++ LAK +I E Sbjct: 1053 KEDTKLGEKCANIVQLQVDLLSKLADQEKEKHLKYLQSSYKNSLEVQLAKLDIVKE 1108 >SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosaccharomyces pombe|chr 2|||Manual Length = 352 Score = 25.8 bits (54), Expect = 7.5 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -3 Query: 279 STYIPHLNFKVRREYPDTAANAVLFAFRTISPFYRIPWNSNAQA 148 STY P L V D N F I+P+Y WN A A Sbjct: 257 STYWPALAAPVYPSMKDVPNNPFT-PFSPINPYYAKSWNHTASA 299 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 7.5 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 218 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 81 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 25.8 bits (54), Expect = 7.5 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -2 Query: 700 SSELTVERRSYRIVPIAHETKPTRLTARKIRGRPENAGPDPVRNVRRFS 554 SS+++ E S + +KP+R TA K + + ++ GP+ R + F+ Sbjct: 335 SSDVSTESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSFA 383 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 10.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 476 TNIDQTRHRPHPLPVQTRHAPV 411 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 10.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 364 FPYLHYSID*RLFTLETCCGYGYEPARHL 278 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity protein kinase Mph1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 25.4 bits (53), Expect = 10.0 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -2 Query: 265 SPEFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRRLQA 104 +P + P VSGH LR+ IS SM +ERS R ++ + + Sbjct: 611 TPLAKKPLPVSGHTNNAHPLRLSTEISASQLSMIIERSVELSKHKRLNKELIDS 664 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 25.4 bits (53), Expect = 10.0 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 6/80 (7%) Frame = -1 Query: 446 HPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALH-----LGDLLRIWVRTGAT 282 HP ++ R+ P+ N Y+ + + L + L + + +G ++ ++V +G+T Sbjct: 254 HPFYMEQRYIPIGTTNTYTSASHGVLMLSSNGMEVLLRSTYIKYRMIGGIIDLFVYSGST 313 Query: 281 -SPRTSLT*ISRSAESIRTP 225 SP+ + I + +SI TP Sbjct: 314 VSPKYT---IQQYVQSIGTP 330 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,530,480 Number of Sequences: 5004 Number of extensions: 75652 Number of successful extensions: 211 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 211 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 408446760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -