BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0092 (667 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3H7.01 |spo14|stl1, SPBP16F5.01c|WD repeat protein Spo14|Sch... 29 0.46 SPAC1610.04 |mug99||meiotically upregulated gene Mug99|Schizosac... 27 3.2 SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pom... 26 4.2 >SPBC3H7.01 |spo14|stl1, SPBP16F5.01c|WD repeat protein Spo14|Schizosaccharomyces pombe|chr 2|||Manual Length = 395 Score = 29.5 bits (63), Expect = 0.46 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = -2 Query: 390 LCINFVNSSRNISKLKLNYALLTVFMRKILVIPNDSAYIYIFLXI 256 LC+ FV +N+S +KL A V +R L+ P A +Y +L + Sbjct: 322 LCLQFVGKFKNLSAVKLEDA--GVILRLSLMFPFVLAILYFYLQL 364 >SPAC1610.04 |mug99||meiotically upregulated gene Mug99|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/32 (31%), Positives = 22/32 (68%) Frame = -3 Query: 257 LTLLMRKGHMSKSICEIEYYVGEMSLSGDNRS 162 L L++ ++ KS E+ + +GE+S +GD+++ Sbjct: 336 LKQLIKDEYLQKSKLELSFILGELSKNGDDKN 367 >SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1562 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 209 FRKYFSTYGLFALKVSIXKNI*IYAESFGITSIFLIN 319 F ++ TY LF +K NI Y + +IF++N Sbjct: 1395 FLVFYVTYSLFGMKELNDNNIFAYGQLIFTAAIFIMN 1431 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,678,588 Number of Sequences: 5004 Number of extensions: 54145 Number of successful extensions: 137 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -