BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0092 (667 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41691| Best HMM Match : CstA (HMM E-Value=0.62) 30 1.9 SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_41691| Best HMM Match : CstA (HMM E-Value=0.62) Length = 406 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/68 (25%), Positives = 32/68 (47%) Frame = +3 Query: 159 ATSVVTTERHFSNIIFYFANTFRHMAFSH*KCQXSKIYKYMRNHLVSLVFFS*ILSKERS 338 A + T ++H+ FYF N F + + Q + +R HL +L+ S ++ + Sbjct: 307 AVNTNTNKKHYGKASFYFVNCFYSLFYIAFYLQDIAL---LRTHLAALMITSQVIGQITE 363 Query: 339 LVLVYLCF 362 ++ YL F Sbjct: 364 SLVPYLMF 371 >SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 87 TFTRESTSSERGTGWRGPSSAEHSATSVVTTE 182 T + ST++ RG+ G +S +ATS + TE Sbjct: 108 TIAQTSTAAPRGSSTEGRTSTRETATSSINTE 139 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,318,475 Number of Sequences: 59808 Number of extensions: 375562 Number of successful extensions: 851 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -