BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0088 (330 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 1.9 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 1.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 2.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 4.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 20 5.8 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 20 7.7 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 20 7.7 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 20 7.7 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 20 7.7 AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase l... 20 7.7 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 20 7.7 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 1.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 45 GRWPWKSESGKECATTHLPKQPAL 116 GR WK + AT L K P+L Sbjct: 79 GRKAWKHLDFRNSATAELLKNPSL 102 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 1.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 45 GRWPWKSESGKECATTHLPKQPAL 116 GR WK + AT L K P+L Sbjct: 79 GRKAWKHLDFRNSATAELLKNPSL 102 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 2.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 303 GVLLLPPRSAPTEAQSVHAQ 244 G L+ PP A Q VHAQ Sbjct: 78 GNLVFPPFRAEDYRQEVHAQ 97 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 20.6 bits (41), Expect = 4.4 Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 142 QNASAPSIFRAG--CFGR*VVAHSLPDSDFHGHRPAVMSDQRLS 17 + A AP++ AG R H HRPA+ +R++ Sbjct: 274 ERAPAPAVRAAGDAAAARGAARADGAGGPLHDHRPALAQQRRVA 317 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 20.2 bits (40), Expect = 5.8 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -3 Query: 58 HGHRPAVMSDQRLSWCP 8 +GH P V+ D+ + CP Sbjct: 309 YGHTPNVVLDEEGNPCP 325 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 19.8 bits (39), Expect = 7.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 132 QRHPFSGLVASAG 94 +RHPF+ L SAG Sbjct: 435 KRHPFAYLPFSAG 447 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 19.8 bits (39), Expect = 7.7 Identities = 12/45 (26%), Positives = 17/45 (37%) Frame = +3 Query: 63 SESGKECATTHLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH 197 SE K + L PA + +YT GT ++W H Sbjct: 59 SEGNKCYSKDLLFNLPAQGSEDCLFLNVYTPKNGTNSKPVMVWVH 103 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 19.8 bits (39), Expect = 7.7 Identities = 12/45 (26%), Positives = 17/45 (37%) Frame = +3 Query: 63 SESGKECATTHLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH 197 SE K + L PA + +YT GT ++W H Sbjct: 59 SEGNKCYSKDLLFNLPAQGSEDCLFLNVYTPKNGTNSKPVMVWVH 103 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 19.8 bits (39), Expect = 7.7 Identities = 12/45 (26%), Positives = 17/45 (37%) Frame = +3 Query: 63 SESGKECATTHLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH 197 SE K + L PA + +YT GT ++W H Sbjct: 61 SEGNKCYSKDLLFNLPAQGSEDCLFLNVYTPKNGTNSKPVMVWVH 105 >AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase like protein E2 protein. Length = 134 Score = 19.8 bits (39), Expect = 7.7 Identities = 12/45 (26%), Positives = 17/45 (37%) Frame = +3 Query: 63 SESGKECATTHLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIWYH 197 SE K + L PA + +YT GT ++W H Sbjct: 33 SEGNKCYSKDLLFNLPAQGSEDCLFLNVYTPKNGTNSKPVMVWVH 77 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 19.8 bits (39), Expect = 7.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 132 QRHPFSGLVASAG 94 +RHPF+ L SAG Sbjct: 435 KRHPFAYLPFSAG 447 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,530 Number of Sequences: 336 Number of extensions: 1702 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6367260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -