BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0088 (330 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 71 3e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 3e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 3e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 3e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 3e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 50 6e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 6e-07 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 7e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 45 2e-05 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 5e-04 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.001 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.014 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.014 SB_27115| Best HMM Match : SAM_1 (HMM E-Value=1.7e-08) 28 1.6 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 28 2.1 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 27 2.8 SB_24532| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.7 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 27 4.9 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 26 6.5 SB_41945| Best HMM Match : Disintegrin (HMM E-Value=2.4) 26 8.5 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 70.5 bits (165), Expect = 3e-13 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +3 Query: 39 TAGRWPWKSESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 TAGRWPWK ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 70.5 bits (165), Expect = 3e-13 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +3 Query: 39 TAGRWPWKSESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 TAGRWPWK ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 70.5 bits (165), Expect = 3e-13 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +3 Query: 39 TAGRWPWKSESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 TAGRWPWK ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 55.2 bits (127), Expect = 1e-08 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +3 Query: 39 TAGRWPWKSESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 TAGR + ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 50.8 bits (116), Expect = 3e-07 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +3 Query: 60 KSESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 K ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 50.8 bits (116), Expect = 3e-07 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +3 Query: 60 KSESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 K ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 50.8 bits (116), Expect = 3e-07 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = +3 Query: 60 KSESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 K ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 49.6 bits (113), Expect = 6e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = +3 Query: 66 ESGKECATTHLPKQPALKMDGAEAFCLYTTV 158 ES KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 2e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 69 SGKECATTHLPKQPALKMDGAEAFCLYTTV 158 S KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 2e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 69 SGKECATTHLPKQPALKMDGAEAFCLYTTV 158 S KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 2e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 69 SGKECATTHLPKQPALKMDGAEAFCLYTTV 158 S KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 2e-06 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +3 Query: 69 SGKECATTHLPKQPALKMDGAEAFCLYTTV 158 S KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 46.0 bits (104), Expect = 7e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +3 Query: 75 KECATTHLPKQPALKMDGAEAFCLYTTV 158 KEC TTHLPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTHLPKQLALKMDGAQASHLYRAV 67 Score = 38.7 bits (86), Expect = 0.001 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = +1 Query: 1 RSWDTMKGVGRS*QQDGGHGSRNPVR 78 RS D KGVG S QQDGGHGS NP + Sbjct: 15 RSSDPTKGVGCSRQQDGGHGSWNPAK 40 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 44.8 bits (101), Expect = 2e-05 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +1 Query: 1 RSWDTMKGVGRS*QQDGGHGSRNPVRSVQRL 93 RS D KGVG S QQDGGHGS NP+R QRL Sbjct: 15 RSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 1e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +3 Query: 75 KECATTHLPKQPALKMDGAEAFCLYTTV 158 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 Score = 39.1 bits (87), Expect = 9e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = +1 Query: 1 RSWDTMKGVGRS*QQDGGHGSRNPVR 78 RS D KGVG S QQDGGHGS NP++ Sbjct: 15 RSSDPTKGVGCSRQQDGGHGSWNPLK 40 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 39.9 bits (89), Expect = 5e-04 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 2 AHGTP*KALVAHDSRTVAMEVGIR 73 AH TP K LVA DSRTVAMEVGIR Sbjct: 10 AHQTPQKVLVALDSRTVAMEVGIR 33 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 38.3 bits (85), Expect = 0.001 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +3 Query: 60 KSESGKECATTHLPKQPALKM 122 K ES KEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.1 bits (77), Expect = 0.014 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 147 IGKTLQRHPFSGLVASAGESLHTPY 73 IG TL+RHPFSGLVASA + TP+ Sbjct: 24 IGATLERHPFSGLVASAEQP--TPF 46 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 35.1 bits (77), Expect = 0.014 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 147 IGKTLQRHPFSGLVASAGESLHTPY 73 IG TL+RHPFSGLVASA + TP+ Sbjct: 22 IGATLERHPFSGLVASAEQP--TPF 44 >SB_27115| Best HMM Match : SAM_1 (HMM E-Value=1.7e-08) Length = 527 Score = 28.3 bits (60), Expect = 1.6 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = -1 Query: 321 VFQG-FAGVLLLPPRSAPTEAQSVHAQTLLRSPWRTSYSL--RLNDT-KLKI 178 VF G A + LLPPR T SV +TLL ++ S+ L+DT K KI Sbjct: 151 VFPGESAAIRLLPPRHWQTSEDSVTDETLLEDEYQAMASIFESLDDTLKSKI 202 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 230 LRGARPTRYGLMIPN*KFSITRA 162 L G +PTRYG P K +ITRA Sbjct: 174 LTGKKPTRYGYSTPLAKSNITRA 196 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 27.5 bits (58), Expect = 2.8 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = +3 Query: 54 PWKSESGKECATTHLPKQPALKMDGAEAFCLYTTVTGTCDAKFLIW 191 P+ S E A T P Q ++G Y +T C +F IW Sbjct: 140 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGCQFYIW 185 >SB_24532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 27.1 bits (57), Expect = 3.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 38 DSRTVAMEVGIR 73 DSRTVAMEVGIR Sbjct: 24 DSRTVAMEVGIR 35 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 26.6 bits (56), Expect = 4.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -3 Query: 91 VVAHSLPDSDFHGHRPAVMSDQRLSWCPMS 2 + H + ++DF G R A+M+D +L C S Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSS 415 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 26.2 bits (55), Expect = 6.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 27 WSLMTAGRWPWKSES 71 W M AG WPWK ++ Sbjct: 216 WYEMIAGGWPWKKQN 230 >SB_41945| Best HMM Match : Disintegrin (HMM E-Value=2.4) Length = 626 Score = 25.8 bits (54), Expect = 8.5 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +3 Query: 150 TTVTGTCDAKFLIWYH*AVTSRTCATESAEGSGRE 254 +T GTC + LI+ TS++C + +++G+ ++ Sbjct: 385 STSKGTCCSDDLIFVEETATSKSCTSSTSKGTTQQ 419 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,090,833 Number of Sequences: 59808 Number of extensions: 229298 Number of successful extensions: 693 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 463065397 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -