BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0088 (330 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 25 0.18 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 0.41 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 0.41 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 2.9 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 20 6.7 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 20 8.9 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 25.4 bits (53), Expect = 0.18 Identities = 14/68 (20%), Positives = 34/68 (50%) Frame = -3 Query: 319 LPGLRWSIATTTKICTDGGSKRSRPDPSALSVAHVLLVTA**YQIKNLASHVPVTVVYRQ 140 +P + + T T + D S S + H+L ++ +Q+ + +++ P ++Y + Sbjct: 261 IPAVTMMLLTLTVLWLDSRSTERMIAASVNLICHILCMSDLHWQLPHNSTNPPNILLYYR 320 Query: 139 NASAPSIF 116 ++ A S+F Sbjct: 321 DSLALSVF 328 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 0.41 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -1 Query: 303 GVLLLPPRSAPTEAQSVHAQT---LLRSPWRTSYSLRLN 196 G L+ PP A Q VHAQ L RSP + +S +N Sbjct: 58 GNLVFPPFRAEDYRQEVHAQVYSCLARSPAGSVHSRDVN 96 Score = 19.8 bits (39), Expect = 8.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +3 Query: 255 RFEPPSVQILVVVAILQRSP 314 RFEPP ++ LQ P Sbjct: 390 RFEPPQIRQAFAEETLQPGP 409 Score = 19.8 bits (39), Expect = 8.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 138 TLQRHPFSGLVASAGESLHTPYRIPT 61 T+Q+ F+ L +AGE + +PT Sbjct: 584 TIQQFSFTKLPMNAGEFANLQCIVPT 609 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.2 bits (50), Expect = 0.41 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 83 CNDSPAEATSPENGW 127 C D P E PE+GW Sbjct: 642 CRDIPEEFLRPESGW 656 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 2.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 142 AYTLPLPARVMLNF 183 ++ +PLP RV+ NF Sbjct: 222 SFCIPLPVRVLPNF 235 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 20.2 bits (40), Expect = 6.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 270 TEAQSVHAQTLLRSPWRTSYSLRLNDTKLKI 178 TEA V + L W+ + +LR + TK I Sbjct: 79 TEAFEVDLEFYLGKEWKKNLNLRDSVTKYLI 109 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 19.8 bits (39), Expect = 8.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 284 GGSSNTPAKP 313 GG S TPA P Sbjct: 20 GGGSTTPASP 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,811 Number of Sequences: 438 Number of extensions: 2149 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7342137 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -