BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0084 (757 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003459-1|AAO39462.1| 925|Drosophila melanogaster RH30917p pro... 29 9.1 AE014298-780|AAF46066.2| 725|Drosophila melanogaster CG33080-PB... 29 9.1 AE014298-779|AAF46068.2| 925|Drosophila melanogaster CG33080-PA... 29 9.1 >BT003459-1|AAO39462.1| 925|Drosophila melanogaster RH30917p protein. Length = 925 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 145 VTHDTTARPYWSIPTKEIPASLSRRRIFKYT 53 V H P W IP E+P SL+ I Y+ Sbjct: 505 VLHSLLEEPVWRIPHTELPESLNESAICDYS 535 >AE014298-780|AAF46066.2| 725|Drosophila melanogaster CG33080-PB, isoform B protein. Length = 725 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 145 VTHDTTARPYWSIPTKEIPASLSRRRIFKYT 53 V H P W IP E+P SL+ I Y+ Sbjct: 305 VLHSLLEEPVWRIPHTELPESLNESAICDYS 335 >AE014298-779|AAF46068.2| 925|Drosophila melanogaster CG33080-PA, isoform A protein. Length = 925 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 145 VTHDTTARPYWSIPTKEIPASLSRRRIFKYT 53 V H P W IP E+P SL+ I Y+ Sbjct: 505 VLHSLLEEPVWRIPHTELPESLNESAICDYS 535 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,839,324 Number of Sequences: 53049 Number of extensions: 668919 Number of successful extensions: 1669 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1669 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3458330568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -