BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0080 (573 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC106949-1|AAI06950.1| 600|Homo sapiens RSHL3 protein protein. 32 1.2 AL132795-2|CAI20497.1| 716|Homo sapiens protein ( ial spokehead... 32 1.2 AL132795-1|CAI20496.1| 469|Homo sapiens protein ( Human DNA seq... 32 1.2 D88378-1|BAA13603.1| 271|Homo sapiens proteasome inhibitor hPI3... 31 2.2 BC126462-1|AAI26463.1| 271|Homo sapiens proteasome (prosome, ma... 31 2.2 AL031665-3|CAI21754.2| 263|Homo sapiens proteasome (prosome, ma... 31 2.2 AL031665-2|CAC10383.1| 271|Homo sapiens proteasome (prosome, ma... 31 2.2 AK125693-1|BAC86247.1| 321|Homo sapiens protein ( Homo sapiens ... 31 2.9 AL672142-8|CAO72148.1| 97|Homo sapiens phytanoyl-CoA dioxygena... 31 3.8 U12259-1|AAA80574.1| 283|Homo sapiens paired box homeotic prote... 29 8.8 U02368-1|AAC50053.1| 836|Homo sapiens PAX3 protein-forkhead tra... 29 8.8 U02309-1|AAA03628.1| 332|Homo sapiens PAX-3 protein. 29 8.8 U02308-1|AAA03627.1| 689|Homo sapiens protein ( Human PAX-3-FKH... 29 8.8 D79994-1|BAA11489.2| 1366|Homo sapiens KIAA0172 protein. 29 8.8 BC114363-1|AAI14364.1| 483|Homo sapiens paired box 3 protein. 29 8.8 BC101302-1|AAI01303.1| 483|Homo sapiens paired box 3 protein. 29 8.8 BC101301-1|AAI01302.1| 484|Homo sapiens paired box 3 protein. 29 8.8 BC101300-1|AAI01301.1| 483|Homo sapiens paired box 3 protein. 29 8.8 BC101299-1|AAI01300.1| 483|Homo sapiens paired box 3 protein. 29 8.8 BC092463-1|AAH92463.1| 524|Homo sapiens 1-acylglycerol-3-phosph... 29 8.8 BC037495-1|AAH37495.1| 1352|Homo sapiens ANKRD15 protein protein. 29 8.8 AY734233-1|AAU34184.1| 524|Homo sapiens Plsc-domain containing ... 29 8.8 AY251280-1|AAP13873.1| 407|Homo sapiens paired box 3 splice var... 29 8.8 AY251279-1|AAP13872.1| 403|Homo sapiens paired box 3 splice var... 29 8.8 AL136979-3|CAH70388.1| 1352|Homo sapiens ankyrin repeat domain 1... 29 8.8 AL136979-2|CAH70387.1| 978|Homo sapiens ankyrin repeat domain 1... 29 8.8 AL031665-4|CAI21757.1| 106|Homo sapiens proteasome (prosome, ma... 29 8.8 AF542964-1|AAN33178.1| 306|Homo sapiens PlSC domain containing ... 29 8.8 >BC106949-1|AAI06950.1| 600|Homo sapiens RSHL3 protein protein. Length = 600 Score = 32.3 bits (70), Expect = 1.2 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -1 Query: 312 LGDLLRIWVRTGATSPRTSPPEFSRSAESIRTPPQMRCSSRSEPYLP 172 LG+ R W A SP+ S PE S E+ + P R S S P+ P Sbjct: 17 LGETRRPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSP 63 >AL132795-2|CAI20497.1| 716|Homo sapiens protein ( ial spokehead-like 1, a novel ).). Length = 716 Score = 32.3 bits (70), Expect = 1.2 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -1 Query: 312 LGDLLRIWVRTGATSPRTSPPEFSRSAESIRTPPQMRCSSRSEPYLP 172 LG+ R W A SP+ S PE S E+ + P R S S P+ P Sbjct: 17 LGETRRPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSP 63 >AL132795-1|CAI20496.1| 469|Homo sapiens protein ( Human DNA sequence from clone RP3-412I7 on chromosome 6q22.1-22.33 Contains a gene similar to murine radial spokehead-like 1, a novel ). Length = 469 Score = 32.3 bits (70), Expect = 1.2 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -1 Query: 312 LGDLLRIWVRTGATSPRTSPPEFSRSAESIRTPPQMRCSSRSEPYLP 172 LG+ R W A SP+ S PE S E+ + P R S S P+ P Sbjct: 17 LGETRRPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSP 63 >D88378-1|BAA13603.1| 271|Homo sapiens proteasome inhibitor hPI31 subunit protein. Length = 271 Score = 31.5 bits (68), Expect = 2.2 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 291 WVRTGATSP-RTSPPEFSRSAESIRTPPQMRCSSRSEPYLPSIG 163 W + +SP R PP +R + +R PP +SR P+ +G Sbjct: 146 WEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLG 189 >BC126462-1|AAI26463.1| 271|Homo sapiens proteasome (prosome, macropain) inhibitor subunit 1 (PI31) protein. Length = 271 Score = 31.5 bits (68), Expect = 2.2 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 291 WVRTGATSP-RTSPPEFSRSAESIRTPPQMRCSSRSEPYLPSIG 163 W + +SP R PP +R + +R PP +SR P+ +G Sbjct: 146 WEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLG 189 >AL031665-3|CAI21754.2| 263|Homo sapiens proteasome (prosome, macropain) inhibitor subunitine-gamma-glutamyltransferase) protein. Length = 263 Score = 31.5 bits (68), Expect = 2.2 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 291 WVRTGATSP-RTSPPEFSRSAESIRTPPQMRCSSRSEPYLPSIG 163 W + +SP R PP +R + +R PP +SR P+ +G Sbjct: 146 WEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLG 189 >AL031665-2|CAC10383.1| 271|Homo sapiens proteasome (prosome, macropain) inhibitor subunitunit 16B protein. Length = 271 Score = 31.5 bits (68), Expect = 2.2 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 291 WVRTGATSP-RTSPPEFSRSAESIRTPPQMRCSSRSEPYLPSIG 163 W + +SP R PP +R + +R PP +SR P+ +G Sbjct: 146 WEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLG 189 >AK125693-1|BAC86247.1| 321|Homo sapiens protein ( Homo sapiens cDNA FLJ43705 fis, clone TESOP2001818. ). Length = 321 Score = 31.1 bits (67), Expect = 2.9 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 8 PIPEPGSGTVSIIVPSSLKTSVRRGNPKWPEDAAER 115 P+P G+ T ++PS+L+ ++ G P W ED+ R Sbjct: 228 PLPPKGTETFFCVLPSALRAALSCG-PSWGEDSGPR 262 >AL672142-8|CAO72148.1| 97|Homo sapiens phytanoyl-CoA dioxygenase domain containing 1 protein. Length = 97 Score = 30.7 bits (66), Expect = 3.8 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = -3 Query: 406 PGPQSQSLFRSYGSNLPTSLTYIILSTRGTSPWRPAADMGTNR 278 PGP S S+ + Y TSLT T TS WRP A G R Sbjct: 53 PGPWSSSMEKWYTRASRTSLTARARPTLSTS-WRPLAPPGARR 94 >U12259-1|AAA80574.1| 283|Homo sapiens paired box homeotic protein protein. Length = 283 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 131 TVHRPQPLPPSTVHQSTIPSNPDS 154 >U02368-1|AAC50053.1| 836|Homo sapiens PAX3 protein-forkhead transcription factor fusion protein. Length = 836 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 327 TVHRPQPLPPSTVHQSTIPSNPDS 350 >U02309-1|AAA03628.1| 332|Homo sapiens PAX-3 protein. Length = 332 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 180 TVHRPQPLPPSTVHQSTIPSNPDS 203 >U02308-1|AAA03627.1| 689|Homo sapiens protein ( Human PAX-3-FKHR gene fusion mRNA, partial cds. ). Length = 689 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 180 TVHRPQPLPPSTVHQSTIPSNPDS 203 >D79994-1|BAA11489.2| 1366|Homo sapiens KIAA0172 protein. Length = 1366 Score = 29.5 bits (63), Expect = 8.8 Identities = 25/90 (27%), Positives = 35/90 (38%), Gaps = 3/90 (3%) Frame = -1 Query: 273 TSPRTSPPEFSRSAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAA--- 103 ++P + PP ++ T P+ R P LP H T+TL + R+ A Sbjct: 129 STPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQM 188 Query: 102 SSGHFGLPRRTLVFKDEGTIIETVPLPGSG 13 + G F P R F GT GSG Sbjct: 189 TPGEFRRP-RLASFGGMGTTSSLPSFVGSG 217 >BC114363-1|AAI14364.1| 483|Homo sapiens paired box 3 protein. Length = 483 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 326 TVHRPQPLPPSTVHQSTIPSNPDS 349 >BC101302-1|AAI01303.1| 483|Homo sapiens paired box 3 protein. Length = 483 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 326 TVHRPQPLPPSTVHQSTIPSNPDS 349 >BC101301-1|AAI01302.1| 484|Homo sapiens paired box 3 protein. Length = 484 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 327 TVHRPQPLPPSTVHQSTIPSNPDS 350 >BC101300-1|AAI01301.1| 483|Homo sapiens paired box 3 protein. Length = 483 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 326 TVHRPQPLPPSTVHQSTIPSNPDS 349 >BC101299-1|AAI01300.1| 483|Homo sapiens paired box 3 protein. Length = 483 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 326 TVHRPQPLPPSTVHQSTIPSNPDS 349 >BC092463-1|AAH92463.1| 524|Homo sapiens 1-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acid acyltrans protein. Length = 524 Score = 29.5 bits (63), Expect = 8.8 Identities = 26/68 (38%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = -1 Query: 408 APVLRANPYSEVTDPICRLP--LPTLFYRLEALH---LGDLLRIWVRTGATSPRTSPPEF 244 APVL A P+S DPI LP LP + R E L +G LLR R P Sbjct: 121 APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRF--NQAILVSRHDPASR 178 Query: 243 SRSAESIR 220 R E +R Sbjct: 179 RRVVEEVR 186 >BC037495-1|AAH37495.1| 1352|Homo sapiens ANKRD15 protein protein. Length = 1352 Score = 29.5 bits (63), Expect = 8.8 Identities = 25/90 (27%), Positives = 35/90 (38%), Gaps = 3/90 (3%) Frame = -1 Query: 273 TSPRTSPPEFSRSAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAA--- 103 ++P + PP ++ T P+ R P LP H T+TL + R+ A Sbjct: 115 STPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQM 174 Query: 102 SSGHFGLPRRTLVFKDEGTIIETVPLPGSG 13 + G F P R F GT GSG Sbjct: 175 TPGEFRRP-RLASFGGMGTTSSLPSFVGSG 203 >AY734233-1|AAU34184.1| 524|Homo sapiens Plsc-domain containing protein protein. Length = 524 Score = 29.5 bits (63), Expect = 8.8 Identities = 26/68 (38%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = -1 Query: 408 APVLRANPYSEVTDPICRLP--LPTLFYRLEALH---LGDLLRIWVRTGATSPRTSPPEF 244 APVL A P+S DPI LP LP + R E L +G LLR R P Sbjct: 121 APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRF--NQAILVSRHDPASR 178 Query: 243 SRSAESIR 220 R E +R Sbjct: 179 RRVVEEVR 186 >AY251280-1|AAP13873.1| 407|Homo sapiens paired box 3 splice variant PAX3H protein. Length = 407 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 327 TVHRPQPLPPSTVHQSTIPSNPDS 350 >AY251279-1|AAP13872.1| 403|Homo sapiens paired box 3 splice variant PAX3G protein. Length = 403 Score = 29.5 bits (63), Expect = 8.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 450 TRHRPHPLPVQTXHAPVLRANPYS 379 T HRP PLP T H + +NP S Sbjct: 327 TVHRPQPLPPSTVHQSTIPSNPDS 350 >AL136979-3|CAH70388.1| 1352|Homo sapiens ankyrin repeat domain 15 protein. Length = 1352 Score = 29.5 bits (63), Expect = 8.8 Identities = 25/90 (27%), Positives = 35/90 (38%), Gaps = 3/90 (3%) Frame = -1 Query: 273 TSPRTSPPEFSRSAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAA--- 103 ++P + PP ++ T P+ R P LP H T+TL + R+ A Sbjct: 115 STPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQM 174 Query: 102 SSGHFGLPRRTLVFKDEGTIIETVPLPGSG 13 + G F P R F GT GSG Sbjct: 175 TPGEFRRP-RLASFGGMGTTSSLPSFVGSG 203 >AL136979-2|CAH70387.1| 978|Homo sapiens ankyrin repeat domain 15 protein. Length = 978 Score = 29.5 bits (63), Expect = 8.8 Identities = 25/90 (27%), Positives = 35/90 (38%), Gaps = 3/90 (3%) Frame = -1 Query: 273 TSPRTSPPEFSRSAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAA--- 103 ++P + PP ++ T P+ R P LP H T+TL + R+ A Sbjct: 115 STPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQM 174 Query: 102 SSGHFGLPRRTLVFKDEGTIIETVPLPGSG 13 + G F P R F GT GSG Sbjct: 175 TPGEFRRP-RLASFGGMGTTSSLPSFVGSG 203 >AL031665-4|CAI21757.1| 106|Homo sapiens proteasome (prosome, macropain) inhibitor subunite protein. Length = 106 Score = 29.5 bits (63), Expect = 8.8 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -1 Query: 291 WVRTGATSP-RTSPPEFSRSAESIRTPPQMRCSSRSEPY 178 W + +SP R PP +R + +R PP +SR P+ Sbjct: 5 WEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPW 43 >AF542964-1|AAN33178.1| 306|Homo sapiens PlSC domain containing hypothetical protein protein. Length = 306 Score = 29.5 bits (63), Expect = 8.8 Identities = 26/68 (38%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = -1 Query: 408 APVLRANPYSEVTDPICRLP--LPTLFYRLEALH---LGDLLRIWVRTGATSPRTSPPEF 244 APVL A P+S DPI LP LP + R E L +G LLR R P Sbjct: 121 APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRF--NQAILVSRHDPASR 178 Query: 243 SRSAESIR 220 R E +R Sbjct: 179 RRVVEEVR 186 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,732,551 Number of Sequences: 237096 Number of extensions: 2152175 Number of successful extensions: 6014 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 5623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5998 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5872755824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -