BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0077 (446 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 1.9 At5g42370.1 68418.m05159 expressed protein 29 1.9 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 1.9 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 2.5 At5g60000.1 68418.m07524 hypothetical protein 27 4.4 At5g22390.1 68418.m02612 expressed protein 27 4.4 At3g56510.1 68416.m06284 TBP-binding protein, putative similar t... 27 5.8 At2g05210.1 68415.m00549 expressed protein 27 5.8 At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase fa... 27 5.8 At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase fa... 27 5.8 At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-P... 27 7.6 At3g44430.1 68416.m04774 expressed protein 27 7.6 At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 27 7.6 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 245 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 111 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 184 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 74 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 47 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 178 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 240 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 142 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g60000.1 68418.m07524 hypothetical protein Length = 149 Score = 27.5 bits (58), Expect = 4.4 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -2 Query: 334 RGSSPWRPAADMGTNRRDISTYIPHLNFKVRREYPD-TAANAVLFAFRTISPFYRIPWNS 158 +GS PW+P +GT R+ + + + D T + F FYR WN+ Sbjct: 78 QGSRPWQPRTCIGTFYREAHFGMHETPYVLYNSDKDATESKNSCFVVVKDDGFYR--WNN 135 Query: 157 NAQAEKKTLP 128 N + K P Sbjct: 136 NKRIWDKVFP 145 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 4.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 119 ERSGKSFLFCLSVRVPWNPIEG 184 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At3g56510.1 68416.m06284 TBP-binding protein, putative similar to TBP-binding protein ABT1 GI:6518527 from [Mus musculus] Length = 257 Score = 27.1 bits (57), Expect = 5.8 Identities = 17/68 (25%), Positives = 28/68 (41%) Frame = -2 Query: 211 VLFAFRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSNTRF*RRGNDY*NGSAA 32 +L + + Y P +S AQ +K G G F WV + +R D NG Sbjct: 69 ILAQYGELGRIYLAPEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVAKRVADMLNGEQI 128 Query: 31 GFRNRNRI 8 G + ++ + Sbjct: 129 GGKKKSSV 136 >At2g05210.1 68415.m00549 expressed protein Length = 364 Score = 27.1 bits (57), Expect = 5.8 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -3 Query: 240 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPR 85 +S T C+ +E Y +GF T TLR+KR L S +F PR Sbjct: 282 DSTATLEAFLCNKDAE-YFWGLGFQDTETLRKKRNWL--LGIRESSNFVAPR 330 >At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 530 Score = 27.1 bits (57), Expect = 5.8 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -1 Query: 167 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 48 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 650 Score = 27.1 bits (57), Expect = 5.8 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -1 Query: 167 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 48 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-PROT:P08927- RuBisCO subunit binding-protein beta subunit, chloroplast precursor (60 kDa chaperonin beta subunit, CPN-60 beta) [Pisum sativum]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 597 Score = 26.6 bits (56), Expect = 7.6 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -3 Query: 246 SAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHF 97 S S PP R SS + S F T+++ Q++ FP + AA HF Sbjct: 10 SMGSSLAPPSNRLSSFVS--ISSSSFGRTQSIAQRKARFPKIYAAKQLHF 57 >At3g44430.1 68416.m04774 expressed protein Length = 206 Score = 26.6 bits (56), Expect = 7.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 296 YEPARHLHVHPSPEFQGPQRVSGHRRKCG 210 ++P+R + PSP F G Q+ S R+CG Sbjct: 42 FQPSRI--ISPSPVFNGGQKTSYGGRRCG 68 >At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein similar to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 676 Score = 26.6 bits (56), Expect = 7.6 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 201 RSEPYLPSIGFHGTRTLRQKRK 136 R+ PY+P + F G RTL+ +R+ Sbjct: 288 RTFPYVPDMKFSGNRTLKLERQ 309 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,081,282 Number of Sequences: 28952 Number of extensions: 245799 Number of successful extensions: 742 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -