BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0073 (715 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 4e-19 SB_6254| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_17546| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_29925| Best HMM Match : GYF (HMM E-Value=6.8) 58 7e-09 SB_34583| Best HMM Match : Chlam_OMP3 (HMM E-Value=2.4) 58 9e-09 SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 57 1e-08 SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56722| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56542| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56484| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56050| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53318| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 57 1e-08 SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53107| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 57 1e-08 SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51655| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49414| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48354| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46716| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44926| Best HMM Match : Attractin (HMM E-Value=7) 57 1e-08 SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 57 1e-08 SB_44048| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43745| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43288| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42472| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41544| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40967| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37958| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36504| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36156| Best HMM Match : Attractin (HMM E-Value=7) 57 1e-08 SB_36137| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.8) 57 1e-08 SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34993| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34853| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 57 1e-08 SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 57 1e-08 SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32221| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30935| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30769| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) 57 1e-08 SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_27143| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21431| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21073| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 57 1e-08 SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 57 1e-08 SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_19514| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_18889| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_18095| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17481| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_16836| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_16782| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_16534| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 57 1e-08 SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 57 1e-08 SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 57 1e-08 SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9127| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7349| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7297| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7249| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5041| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4578| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4384| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_3637| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_3280| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_2287| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 57 1e-08 SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59785| Best HMM Match : TBCA (HMM E-Value=3) 57 1e-08 SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003) 57 1e-08 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 57 1e-08 SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58570| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57063| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56114| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 57 1e-08 SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56094| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55844| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54410| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53924| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 57 1e-08 SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50914| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50695| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50534| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 57 1e-08 SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 57 1e-08 SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47857| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46383| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44372| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 57 1e-08 SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_44030| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_43409| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42287| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42209| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42013| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.8) 57 1e-08 SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_41064| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 57 1e-08 SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39338| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38181| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37587| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37354| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 92.3 bits (219), Expect = 4e-19 Identities = 47/66 (71%), Positives = 55/66 (83%) Frame = +3 Query: 450 LPPNRVSNETMKVVVFQRRSAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAV 629 LP +R+S +T++VVVF RR A +PTY+TPLMS + RLESSSTGSSFPAD KPVPLAV Sbjct: 67 LPLHRISKKTIRVVVFHRRIA--TPTYSTPLMSFHRVRLESSSTGSSFPADCAKPVPLAV 124 Query: 630 VSLDSR 647 VSLDSR Sbjct: 125 VSLDSR 130 >SB_6254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 60.5 bits (140), Expect = 1e-09 Identities = 32/64 (50%), Positives = 38/64 (59%) Frame = +3 Query: 63 IKRERRYERLAATSQXXXXXXXXXXXXXXXYTKGSIGRAFAVPMRTEHLDQASFCPFAPR 242 IK++RRYERLAATSQ TKGSIG AF V + TE+ +Q SF PF Sbjct: 23 IKKQRRYERLAATSQLSLWYFSDTSSLKLLKTKGSIGHAFTVCIHTENQNQVSFYPFVLH 82 Query: 243 EVSV 254 E+SV Sbjct: 83 EISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 >SB_17546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 58.4 bits (135), Expect = 5e-09 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL +K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKIK 42 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = +3 Query: 159 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 KGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 42 KGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_29925| Best HMM Match : GYF (HMM E-Value=6.8) Length = 101 Score = 58.0 bits (134), Expect = 7e-09 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLC 195 + SK NVAMNAWLPQASYPCGNFS TS KL K + ++ C Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSRLLTLETCC 66 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_34583| Best HMM Match : Chlam_OMP3 (HMM E-Value=2.4) Length = 227 Score = 57.6 bits (133), Expect = 9e-09 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +1 Query: 43 KRWIVHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 +R + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 119 RRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 158 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 157 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 189 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 181 PFVLHEISVLIELTLGHLRYRLTD 204 >SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 21 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 87 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 79 PFVLHEISVLIELTLGHLRYRLTD 102 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_56722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_56542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_56484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_56050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 41.1 bits (92), Expect = 9e-04 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVGIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_53318| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_53107| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) Length = 120 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGS+G AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_51655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL +GHLRY LTD Sbjct: 78 PFVLHEISVLIELTIGHLRYRLTD 101 >SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_48354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 124 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 116 PFVLHEISVLIELTLGHLRYRLTD 139 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_46716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 59 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFFPFVLHEISV 125 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 117 PFVLHEISVLIELTLGHLRYRLTD 140 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 40 WVNNPTLGEF 49 >SB_44926| Best HMM Match : Attractin (HMM E-Value=7) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVSLSW 266 TKGSIG AF V + TE+ +Q +P V + W Sbjct: 54 TKGSIGHAFTVCIHTENQNQLGQSTNSPFPVQLRPGW 90 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_44048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_43288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_41544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 124 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 116 PFVLHEISVLIELTLGHLRYRLTD 139 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_40967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 89 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 155 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 147 PFVLHEISVLIELTLGHLRYRLTD 170 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 70 WVNNPTLGEF 79 >SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 >SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_37958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGS+G AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_36156| Best HMM Match : Attractin (HMM E-Value=7) Length = 162 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 124 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 116 PFVLHEISVLIELTLGHLRYRLTD 139 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_36137| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.8) Length = 127 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 89 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 70 WVNNPTLGEF 79 >SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_34993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_34853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVSLSW 266 TKGSIG AF V + TE+ +Q +P V + W Sbjct: 54 TKGSIGHAFTVCIHTENQNQLGQSTNSPFPVQLRPGW 90 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 59 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 125 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 117 PFVLHEISVLIELTLGHLRYRLTD 140 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 40 WVNNPTLGEF 49 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 367 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 402 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 401 TKGSIGHAFTVCIHTENHNQVSFYPFVLHEISV 433 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 348 WVNNPTLGEF 357 >SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSI AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIAHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 >SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_32221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 21 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 87 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 79 PFVLHEISVLIELTLGHLRYRLTD 102 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_30935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 26 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 61 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 60 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 92 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/26 (61%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 77 TFPFDG*TIQRLANF-FAMIGRADIE 3 TFP G L F FAMIGRADIE Sbjct: 2 TFPISGVNNPTLGEFCFAMIGRADIE 27 >SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFPVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_30769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 59 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 125 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 117 PFVLHEISVLIELTLGHLRYRLTD 140 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 40 WVNNPTLGEF 49 >SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) Length = 128 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_27143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 124 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 116 PFVLHEISVLIELTLGHLRYRLTD 139 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 21 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 87 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 79 PFVLHEISVLIELTLGHLRYRLTD 102 >SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 21 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q S PF E+SV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSSYPFVLHEISV 87 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 79 PFVLHEISVLIELTLGHLRYRLTD 102 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 >SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 21 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 87 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 79 PFVLHEISVLIELTLGHLRYRLTD 102 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 2 WVNNPTLGEF 11 >SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 38 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 73 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 72 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 104 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 96 PFVLHEISVLIELTLGHLRYRLTD 119 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 19 WVNNPTLGEF 28 >SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_21073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) Length = 128 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 172 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 207 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 206 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 238 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 230 PFVLHEISVLIELTLGHLRYRLTD 253 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 153 WVNNPTLGEF 162 >SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 58 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 124 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 116 PFVLHEISVLIELTLGHLRYRLTD 139 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 39 WVNNPTLGEF 48 >SB_18889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_18095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 73 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 65 PFVLHEISVLIELTLGHLRYRLTD 88 >SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 7 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 Score = 36.7 bits (81), Expect = 0.019 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF F E+SV Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYLFVLHEISV 73 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +2 Query: 254 LAELALGHLRYSLTD 298 L EL LGHLRY LTD Sbjct: 74 LIELTLGHLRYRLTD 88 >SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 >SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +1 Query: 55 VHPSKGNVAMNAWLPQASYPCGNFSGTSC*KLFILK 162 + SK NVAMNAWLPQASYPCGNFS TS KL K Sbjct: 20 IEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +3 Query: 156 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSV 254 TKGSIG AF V + TE+ +Q SF PF E+SV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISV 86 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 227 PFCSTRGFCLAELALGHLRYSLTD 298 PF L EL LGHLRY LTD Sbjct: 78 PFVLHEISVLIELTLGHLRYRLTD 101 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 63 WVNNPTLGEF 34 WVNNPTLGEF Sbjct: 1 WVNNPTLGEF 10 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,208,200 Number of Sequences: 59808 Number of extensions: 506772 Number of successful extensions: 4713 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4709 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -